[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for atum0:AAK87989.1


[Show Plain Result]

## Summary of Sequence Search
   1::303
  21::302  PF01218 0.0% 48.0916030534351  Coproporphyrinogen III oxidase 
   1::303


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MERPILPKGLPEDIEDKKAVAQAWFQHLRDTIVASFETLEDELTGPLSDQEPGRFVQKDWLRDNGEGGGG
PF01218         --------------------veellkelqdeivealealdg..........kakfkedewereeg.GgGi


                         -         -         *         -         -         -         -:140
query           KMSMMEGRVFEKVGVHTSTVYGEFSPEFRKQIPGAEEDPRFWASGLSLIAHPVNPNVPAVHMNTRMVVTT
PF01218         srvleeGkvfEkagvnvsvvsgellpeaasakraelagakfeaagvslviHpknPlvPtvhlnvRlfvae


                         +         -         -         -         -         *         -:210
query           SHWFGGGADLTPVLGRRRTQQDPDTQLFHRAFEITCNRHPIADYPRYKSWCDEYFFLKHRDEPRGTGGIF
PF01218         kegeekawWfGGGaDltPlyl.....feedakhfhktlkeacdkfdeelyprfkkwcDeYFylkhRkeaR


                         -         -         -         +         -         -         -:280
query           FDWLHPDEEKGGWDANFTFVQDVGRAFNLVYPKIVRANFNQNWTEEDRDEQLIRRGRYVEFNLLYDRGTI
PF01218         GvGGiffddlne....kdfeksfafvksvgeafleaylpivekrkdkeyteeerefqllrRgrYvEfnLv


                         -         *         -         -         -         -         +:350
query           FGLKTGGNVESILSSLPPVVRWP-----------------------------------------------
PF01218         yDrGtkfGlqtggrtesilmsl------------------------------------------------