[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for atum0:AAK88186.2


[Show Plain Result]

## Summary of Sequence Search
   1::177
  61::167  PF06035 0.0% 36.4485981308411  Bacterial protein of unknown function (DUF920) 
   1::177


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLKKIIAAAICGIAIASMSTHADAAGAAGFARGFAAVEKSAVTAIGISAPGGFDGCVLAAGQCVSTIAAP
PF06035         ------------------------------------------------------------keCkakskea


                         -         -         *         -         -         -         -:140
query           LTVERREELLRVNRDVNATMGALDDYVSGFATDLPATPSVSLGDCGDCAAIKRTALAGAGWSSNALRLAF
PF06035         ekvklteellkelvevnaevneaikpvtdlelygveevWaypekgaGDCedyvllKrkeLieaGipasal


                         +         -         -         -         -         *         -:210
query           ALKGDGSLEKVLIVTTDKGDIVLGNATFSPASRETAL---------------------------------
PF06035         lltvvrkkdgegHavLtvrtdkGdfvL-------------------------------------------