[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for atum0:AAK88218.2


[Show Plain Result]

## Summary of Sequence Search
   1::281
  49::273  PF03372 0.0% 17.7777777777778  Endonuclease/Exonuclease/phosphatase family 
   1::281


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKKNGLLDDEKTALTKNTSLSAFVMQSLRDRRQRQNAAPATKDHSFPVIASYNVHKCVGRDRKFDPDRTS
PF03372         ------------------------------------------------vmtwNvnglsastdslfrksal


                         -         -         *         -         -         -         -:140
query           RVIQEIGADIIALQEADSRFGERTGLLDLARLERESGLVPVPVQAGVKAHGWHGNVVLFREGAVRDVHTL
PF03372         lkelkkydpDvicLQEvkleeasnllkaalelegseglkvdvstvktgfgraggkkgGvailskkplfsl


                         +         -         -         -         -         *         -:210
query           KLPGLEPRGALVVELDLKSGGTLRVIAAHFGLLRHSRAQQAKALVGLLEARNECATILMGDLNEWRLGNG
PF03372         vqdsnleyklskklverrrikasgrsfcvvntHlpagpegvderlaqlaelldelsklrsisshdpvilc


                         -         -         -         +         -         -         -:280
query           SSLNTFRDAFGTLPPAVPSFPSNLPVLALDRIIANREGLIEQVEAHDSALARIASDHLPLKAAIRTDLLP
PF03372         GDfNarpdsidykflrdrklqklgdlleedqlleekkagvvfkgfdelpitfapTykfdrgss-------


                         -         *         -         -         -         -         +:350
query           A---------------------------------------------------------------------
PF03372         ----------------------------------------------------------------------