[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for atum0:AAK88284.1


[Show Plain Result]

## Summary of Sequence Search
   1::427
  31::382  PF01266 0.0% 31.1572700296736  FAD dependent oxidoreductase 
  31::77   PF07992 0.0% 47.7272727272727  Pyridine nucleotide-disulphide oxidoreductase 
 195::246  PF07992 0.0% 15.6862745098039  Pyridine nucleotide-disulphide oxidoreductase 
  31::81   PF00890 0.0% 42.5531914893617  FAD binding domain 
  28::73   PF01946 0.0% 44.4444444444444  Thi4 family 
  31::62   PF03486 0.0% 43.75  HI0933-like protein 
 189::241  PF03486 0.0% 28.3018867924528  HI0933-like protein 
  31::61   PF01134 0.0% 48.3870967741936  Glucose inhibited division protein A 
 218::271  PF01134 0.0% 25.9259259259259  Glucose inhibited division protein A 
   1::427


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MYNDPRSHGLWEKTAPQPPVTPALQGDAVADVVVVGGGFTGQSAALHLAEGGLDVILLEAKEIGFGGAGR
PF01266         ------------------------------dvviiGgGivGlstAyeLarrglkVtllekgdiasgaSgr
PF07992         ------------------------------dvviIGgGpaGlaaakrlarlglkvaliere...pggtcl
PF07992         ------------------------------dvviIGgGpaGlaaakrlarlglkvaliere...pggtcl
PF00890         ------------------------------DvvViGsGlAGlaAAleaaeaglkvavvekeq.etgg...
PF01946         ---------------------------aesDvvivGaGssGltaayylakkdlkvailerk.lsiGGGaw
PF03486         ------------------------------dviviGgGaAGlmaAisaakrgakVllldkak--------
PF03486         ------------------------------dviviGgGaAGlmaAisaakrgakVllldkak--------
PF01134         ------------------------------dviViGgGhAGceAAlaaarlGakvlLithk---------
PF01134         ------------------------------dviViGgGhAGceAAlaaarlGakvlLithk---------


                         -         -         *         -         -         -         -:140
query           NVGLINGGMWVMPKELPDVLGETYGERLLDLLGDAPVLVRELVEKHGIPCEIEKNGTLHCAVGEKGLAEI
PF01266         ngglihagl...........lkerdprllrlalesldllrelaaetgidvdfrrtgvldlasdeeeleel
PF07992         nrgcipk---------------------------------------------------------------
PF07992         nrgcipk---------------------------------------------------------------
PF00890         atawsqGgida-----------------------------------------------------------
PF01946         lGG-------------------------------------------------------------------
PF03486         ----------------------------------------------------------------------
PF03486         ----------------------------------------------------------------------
PF01134         ----------------------------------------------------------------------
PF01134         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           RERCEQWSARGAPVRVLDADETASYIGSTAYSGALLDSRAGTIQPLAYVRGLAGAALKAGVRLHTASPVN
PF01266         erlaerarangldvellsaeevrerepllspdlkgglfypddgqvdpaklvkalaraaeelGveiiegtk
PF07992         ------------------------------------------------------erkdegievllntgvt
PF07992         ------------------------------------------------------erkdegievllntgvt
PF00890         ----------------------------------------------------------------------
PF01946         ----------------------------------------------------------------------
PF03486         ------------------------------------------------vdallkelkeagvkirletevk
PF03486         ------------------------------------------------vdallkelkeagvkirletevk
PF01134         ----------------------------------------------------------------------
PF01134         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           ETGRNGAKWVVKTPEGSVTAKWIVVATEAYSTGPWQIIREEQVYLPYFNFATRPLSDNLQKSILPGRQGC
PF01266         VtglereggrvsgvrtedgsiradkvvlAaGawsskllkllgldlpirpvrgqvlvtepltdelaaavil
PF07992         didkakkkveladgkaevkydklviAtGakprtl.g----------------------------------
PF07992         didkakkkveladgkaevkydklviAtGakprtl.g----------------------------------
PF00890         ----------------------------------------------------------------------
PF01946         ----------------------------------------------------------------------
PF03486         svekeedgafrvktkseeeleadklvlAtGG---------------------------------------
PF03486         svekeedgafrvktkseeeleadklvlAtGG---------------------------------------
PF01134         -------kgvvtedgetikakavviatGtflkgkihigekelsaGrlgeltseglseslke---------
PF01134         -------kgvvtedgetikakavviatGtflkgkihigekelsaGrlgeltseglseslke---------


                         -         *         -         -         -         -         +:350
query           WDTKEILSSFRMDKAGRLVFGSVGALRGTGTAIHRAWAKRSLKRLFPQLGDTEFECEWYGQIGMTDNAVP
PF01266         gpvavldargvfvlpre...gevlvgttd.grldrgataeessgedvdvdlevdelleaakkllpqlkda
PF07992         ----------------------------------------------------------------------
PF07992         ----------------------------------------------------------------------
PF00890         ----------------------------------------------------------------------
PF01946         ----------------------------------------------------------------------
PF03486         ----------------------------------------------------------------------
PF03486         ----------------------------------------------------------------------
PF01134         ----------------------------------------------------------------------
PF01134         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           RFHKFAENVIGFSGYNGRGIAPGTAFGKVIAQHILGEIAEADLPLPVTEPKAQAFRAVKEAYYEAGAQIA
PF01266         eilrawaGlrpvtpdglpvigevpevpglyva--------------------------------------
PF07992         ----------------------------------------------------------------------
PF07992         ----------------------------------------------------------------------
PF00890         ----------------------------------------------------------------------
PF01946         ----------------------------------------------------------------------
PF03486         ----------------------------------------------------------------------
PF03486         ----------------------------------------------------------------------
PF01134         ----------------------------------------------------------------------
PF01134         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           HFAGERF---------------------------------------------------------------
PF01266         ----------------------------------------------------------------------
PF07992         ----------------------------------------------------------------------
PF07992         ----------------------------------------------------------------------
PF00890         ----------------------------------------------------------------------
PF01946         ----------------------------------------------------------------------
PF03486         ----------------------------------------------------------------------
PF03486         ----------------------------------------------------------------------
PF01134         ----------------------------------------------------------------------
PF01134         ----------------------------------------------------------------------