[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for atum0:AAK88297.2


[Show Plain Result]

## Summary of Sequence Search
   1::215
   1::205  PF08893 0.0% 47.3170731707317  Domain of unknown function (DUF1839) 
   1::215


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPDTHGVGYQKEHGKTTVAINRLDLEKRELDYFHNAGFFHLSGEDFDGLFQHHLAETDPPFLPYTEFAKF
PF08893         lPdtrgtaYrrehvkttiaidvidveakaleYfHnsGyhelegedydglfrlaeelsekdalllpyvevv


                         -         -         *         -         -         -         -:140
query           ADSNPSPAHIRKTAERLLKFHFSRRPSANPVRAFAKVFPAQVEKVADRPFGFFHKYAFNTLRQLGANFEL
PF08893         kreekaleeaalleaslellrrHlkrrPeeNPvkafreafpadletllereeeaFhkYafnvlRqlGAnf


                         +         -         -         -         -         *         -:210
query           AASHLEWLDKQGFSDARDHALKISEVAKTVQFQLARAVTRRKFDALATVLDPAADAWDGLMESLGEKLSD
PF08893         EllarylrwLeeegkevpakaaeaartiaseakvlqFrLaRavarkkadeledsLdqleaayekl-----


                         -         -         -         +         -         -         -:280
query           ASEAA-----------------------------------------------------------------
PF08893         ----------------------------------------------------------------------