[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for atum0:AAK88391.2


[Show Plain Result]

## Summary of Sequence Search
   1::215
  19::210  PF01810 0.0% 29.9465240641711  LysE type translocator 
   1::215


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDFVPSLPTLIAFTIAILLLAVTPGPDMTLWISRSLREGRAAGFMTLVGTNIGITVHTMLVAFGVAALIV
PF01810         ------------------slllppGpqnafvlkqgikrgfkhgllvalgallgdlvlillgvlGlalllk


                         -         -         *         -         -         -         -:140
query           ASPTAFMILKTGGAAYLVWLAIQAIRKGSDFVMVKSTGEKAQASLKSALLNGIWVNLLNPKVIIFFMTFL
PF01810         aspivlallrlgGaayLlwlGvlalraamskkseklasse.qrsvkksflmgllvsllNPkaildwlsvi


                         +         -         -         -         -         *         -:210
query           PQFVSATDPHVTGKLIFLGIWSIIVALPIGIGIVVTADILSAWLQRNRKVLRGLDYTIAGVFSLFAVKIF
PF01810         gsfiak.qyaeegriifaaglilasliWfilla..flaallsrrlss.skvqriinvvvgvllvgfgvkl


                         -         -         -         +         -         -         -:280
query           FTQTR-----------------------------------------------------------------
PF01810         ----------------------------------------------------------------------