[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for atum0:AAK88515.1


[Show Plain Result]

## Summary of Sequence Search
   1::210
  12::207  PF02570 0.0% 53.0927835051546  Precorrin-8X methylmutase 
   1::210


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTDYDYIRDGNAIYERSFAIIREEADLSAFTEEQADIAIRMIHACGQVEAAGHFRFSPDFVSAARGALLA
PF02570         -----------eIeaeSfaiIreelgehelseeeeevvrRvihatgdfelaellrfsedaveaglaaLka


                         -         -         *         -         -         -         -:140
query           GKPVLCDAQMVAHGVTHARLPADNAVICTLRDPRTPELAKNIGNTRSAAALDLWADYLDGALVAIGNAPT
PF02570         gapIltDvemvaaGitkkrlktlgnevicllddeevaelakeegktrsaaavekaaeelegaivviGnAp


                         +         -         -         -         -         *         -:210
query           ALFYLLEMLEKGGPRPAAIIGMPVGFVGAAESKDALEASALGIPYAIVKGRLGGSAMTAAAINAVARAGL
PF02570         tALlellelieegkakpalvigvPvGFvgaaesKeaLaes..evpsitveGrkGGsavaaaivnaLl---