[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for atum0:AAK85845.1


[Show Plain Result]

## Summary of Sequence Search
   1::298
  26::288  1.8e-75 38.4% 0052629 00526291 1/1   crotonase                               
  23::288  9.8e-70 33.3% 0051721 00517211 1/1   crotonase                               
  50::284  2.4e-65 37.2% 0041793 00417931 1/1   crotonase                               
  24::285    1e-64 36.5% 0050305 00503051 1/1   crotonase                               
  22::289  2.9e-64 36.8% 0051040 00510401 1/1   crotonase                               
  21::284  1.3e-62 32.8% 0041933 00419331 1/1   crotonase                               
   1::278  3.4e-59 31.2% 0048769 00487691 1/1   crotonase                               
  16::288  5.5e-57 33.3% 0051722 00517221 1/1   crotonase                               
  23::285    3e-53 30.7% 0050306 00503061 1/1   crotonase                               
  25::286  8.9e-52 34.4% 0051041 00510411 1/1   crotonase                               
  13::286  1.2e-45 24.8% 0052628 00526281 1/1   crotonase                               
  24::286  3.8e-45 31.0% 0041934 00419341 1/1   crotonase                               
  15::286  1.3e-29 23.9% 0048770 00487701 1/1   crotonase                               
  22::281  2.6e-20 24.3% 0041794 00417941 1/1   crotonase                               
   1::298


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNWITNYVRPRINSMLGRRPEVPENLWIKCPETGEMVFHKDLEDNKWVIPASGYHMKMPAKARLADLFDG
00526291   1/1  -------------------------lwlklpeleellapallgggllvivpcdargkldarerielllDe
00517211   1/1  ----------------------inledlekkleeleellaklelggnlkvcpkcdahgkltarerldlll
00417931   1/1  -------------------------------------------------aeddahalllarerlsllldp
00503051   1/1  -----------------------eglweklpeleellepllllgglevvvpadhrgrldarerialllDd
00510401   1/1  ---------------------vpeglwlkleeleellepalllgglevvvparhrgrldarerialllDd
00419331   1/1  --------------------elleglweklpeleellepalllgglnrvvpanargrldareridlllDd
00487691   1/1  vsGvadllaeddadalelarellsylpakvlellp..eplrlggellvivprdprgpydareriallvDd
00517221   1/1  ---------------rrllsylpelllrkppal........lggelrvivprhprrpydarerielllDg
00503061   1/1  ----------------------pellllktpdp.....plrlveellvivprdprrpldarerielllDe
00510411   1/1  ------------------------llwvkcpdp.....parlegellvivprdprrpldarerialllDd
00526281   1/1  ------------neelppvleeidellrkleellglipadl..ggwevvqlarhrgrldareriarlvDd
00419341   1/1  -----------------------erllsllprlayallpgelr....vivprhprgpldarerielllDe
00487701   1/1  --------------llsylpelnerlepaldlgd...........ldavvparargrldareriarlvDd
00417941   1/1  ---------------------gelppvleladllerlvivppdggepydvrqviaGkltareridlLvDp


                         -         -         *         -         -         -         -:140
query           GIYEALAQPKVAQDPLKFRDSKKYTDRLRDSRAKTEQEDTILAGVGLLKGLKIVAVVHEFQFMAGSLGIA
00526291   1/1  gsflElgalaaaadplkfldlkkysdrlaealkktgpgdgvvtgigridGrpvgvvandftvlgGslgpv
00517211   1/1  drgsfreydll.viarllddfdelkrlyg............dgvvtgfgringrpvgviandftvlgGsl
00417931   1/1  gsfvelladlpdrdvlellgivpadplkpydvrevierlvddgsflelkarektglgdgvvtgfariktp
00503051   1/1  gsflElgglavaadplkfldlkggpg............dgvvtgigridGrpvgviandftvlgGslgpv
00510401   1/1  gsflElgglaaaadplkfldl............ktgpgdgvvtglgrinGrpvvviandftvlgGslgpv
00419331   1/1  gsflEld............glagyrlrladarlkaglddgvvtgigrigGrpvgviandftvlgGslgpv
00487691   1/1  gsflElkalygpndp...................tglddgvvtgfgrinGrpvgviAndftvlgGslgpv
00517221   1/1  sflEl............................kglygdgvvtglaridGrpvgviandftvlgGslgpe
00503061   1/1  gsflElggl...........................ygdgvvtglaridGrpvgviandftvlgGslgpe
00510411   1/1  gsfleld...........................rlygdgvvtglaridGrpvgviandftvlgGslgpe
00526281   1/1  gsflel.........................drlfglgdgivtGfaridGrpVgviandpgrdtkenltv
00419341   1/1  gsflEldgl...........................pgdgvvtgfaridGrpvgviandftvlgGslgpe
00487701   1/1  gsflElggl...........................ygdgvvtGfaridGrpVgviAndptvllkllpat
00417941   1/1  gsflElgal...........................wadgvVtGrarlgGrpvgvvAndptvleklvPad


                         +         -         -         -         -         *         -:210
query           AGEAIVKAFERAISERCPLVMFPASGGARMQEGILSLMQLPRTTVAVNMLKEAGMPYIVVLTNPTTGGVT
00526291   1/1  saeKiaraielAlelglPliylvdsgGarlgegveslgqigkiakalaalsgagvPvisvvtgpayGgga
00517211   1/1  gpegaeKaaraielAlkfklPlitlvdsgGarpgegaeslgqmgaiakalaalsga.vPvisvitgpayG
00417931   1/1  eypgGrpvgvvandftvlgGslgpvsaekaaraielAdelglPliylvdsgGarlgmqeevlslmqmakt
00503051   1/1  gaeKaaraielAlefglPlitlvdsgGarlgegaeslgqigaiakalaalse.gvPvisvvtgpttGgga
00510401   1/1  gaeKaaraielAlkfglPlitlvdsgGarlgegaeslgqigaiakalaalsg.gvPvisvvtgpttGgga
00419331   1/1  saeKaaraielAdefglPlitlvdsgGarigegaeslrqgakifralarlsg.gvPviavvtgpayGGga
00487691   1/1  saeKaarfielAdefglPlitlvdsgGarlgveqEgvgilragakilyalarlseagvPkitvvtgpayG
00517221   1/1  garKaaraielAdkfglPlvtlvdtgGarpgegaeslgiagaiakalaalseagvPvisvvtgpayGgga
00503061   1/1  garKaaraielAdkfglPlvtlvdsgGarpgegaeslgiigagakllaalseagvPvisvitgpayGgga
00510411   1/1  garKaaraielAdkfglPlvtlvdtgGarpgveqegvgilragakllaalael...gvPvisvvtgpayG
00526281   1/1  lgGslgpegarKaarlielAdkfglPlvtlvdtpGarpgegaeelgiigaiakllaalsgagvPvitvvl
00419341   1/1  sarkaaraielAdkfglPlvtlvdsgGarpgegaeslgiagaiakllaalseagvPviavvlgpayGGga
00487701   1/1  kenvlrngGsldpegarKaarfieladkfglPlitLvdtpGarpgegaealgiigagakllyalasatvP
00417941   1/1  PanldsaeklvqeagGvldpdsadKaaraieDladafglPlviLvdsgGfriGteqegvgilkhgakivy


                         -         -         -         +         -         -         -:280
query           ASYAMLGDVHIAEPGAEICFAGKRVIEQTIREKLPEGFQTSEYLLEHGMVDMVIDRREIPDTLASMLKIM
00526291   1/1  ysmamlgdvviawpnaligvaGpevieavlgeevpeelggaevllesgvidavvdpeetrlvlarlllsl
00517211   1/1  ggayslallddvimaepnaligvagpevveailgeelspeelggaevhllesgviDliidpdldarrllr
00417931   1/1  daalevlgfgylyldeedyelleykqpvlvyipellelrgesrvvvdsiiggiirlgakllygsGrifge
00503051   1/1  ysmallddvimaepnaligvagpeviaailgeevtaeelggaevhllesgvidlvvdpdetrlvlarlll
00510401   1/1  yamallddvimaepnaligvagpevieailgeevd..fetlggllehglidgvideladdpaearallrr
00419331   1/1  ylaal.gdfviavpnArigvagpeviaailgekvaaeellgtaehalesGvvdlvvppdelrlelarlll
00487691   1/1  ggayamal.gdfviawpnariavmgpevaaavlgekvleaaqaaeallelldalvaeilggaellanp--
00517221   1/1  yvmasrallgdfvialpnarigvmgpevaaailgrdelealggaeahllsgvadllaeleeealtaerll
00503061   1/1  yamallalgadfvialpnarigvmgpevaasilgrdvlaaeeaaealrataldllpeelggaevaaelgv
00510411   1/1  ggayamasralladfviawpnarigvmgpevaagilgedelealggaevhalsgvalllaedfataeell
00526281   1/1  geayGggalamal.adfvlalpnaeiavmgpegaaailgedvskaeeaaealkitaydlaelglidgiid
00419341   1/1  yamasralladfvialpnarigvmgpevaaailgrdelrlaeaaealraaliavlteelggaevalelgl
00487701   1/1  kitvvlGkayGggayamaladfgpdllvvlawpnaeiavmgPegaaailgedsleelggaevhaevsgva
00417941   1/1  ala...satvPqitviPplGkaaGGayvvvgskinaladfviawpgariavmGPegavevlfgeevsaee


                         -         *         -         -         -         -         +:350
query           TKAPADNANAVVPLAASA----------------------------------------------------
00526291   1/1  lpknllep--------------------------------------------------------------
00517211   1/1  rllsllps--------------------------------------------------------------
00417931   1/1  tala------------------------------------------------------------------
00503051   1/1  sllpk-----------------------------------------------------------------
00510401   1/1  lLsyllskl-------------------------------------------------------------
00419331   1/1  llln------------------------------------------------------------------
00487691   1/1  ----------------------------------------------------------------------
00517221   1/1  elglidgv--------------------------------------------------------------
00503061   1/1  idavi-----------------------------------------------------------------
00510411   1/1  elglvd----------------------------------------------------------------
00526281   1/1  pelgga----------------------------------------------------------------
00419341   1/1  vddvid----------------------------------------------------------------
00487701   1/1  dllaed----------------------------------------------------------------
00417941   1/1  l---------------------------------------------------------------------