[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for atum0:AAK85915.1


[Show Plain Result]

## Summary of Sequence Search
   1::107
   8::102  8.9e-31 53.8% 0042469 00424691 1/1   like                                    
   4::96   4.7e-28 50.0% 0039418 00394181 1/1   like                                    
   1::107


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRDIMGMMGKVKEMQSKMEKVQQEIAALEIEGRAGGGLVTVILNGKGEMRGLKIDPSLFKEDEVEILEDL
00424691   1/1  -------lkqaqklqekmqelqeelaelevegeaggglVkvtltgkgelkdveidpslldp.dkemledl
00394181   1/1  ---lqnllkqaqklqekmkelqeelaelevegeaggglVkvtltgkgelkdveidpslld.edkemledl


                         -         -         *         -         -         -         -:140
query           IVAAHKDAKEKGEAQAQEKMADLTAGLPLPPGMKLPF---------------------------------
00424691   1/1  ilaAvndAlkkveelakekmskltgglglPgl--------------------------------------
00394181   1/1  ilaAvndAlkkaeelaeekmskltgg--------------------------------------------