[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for atum0:AAK85965.2


[Show Plain Result]

## Summary of Sequence Search
   1::1782
 379::12692.9e-156 37.3% 0046501 00465011 1/1   inked oxidoreductases                   
 401::12691.2e-155 37.2% 0047996 00479961 1/1   inked oxidoreductases                   
   6::378 9.7e-108 38.0% 0040554 00405541 1/1   minal nucleophile aminohydrolases (Ntn  
   6::377  6.7e-86 34.4% 0036865 00368651 1/1   minal nucleophile aminohydrolases (Ntn  
1295::1593 1.3e-67 40.4% 0046500 00465001 1/1    subunit of glutamate synthase, C-termi 
1341::1588 2.6e-64 41.3% 0047995 00479951 1/1    subunit of glutamate synthase, C-termi 
 960::1264 1.4e-36 35.7% 0048029 00480292 2/2   inked oxidoreductases                   
 960::1265 4.9e-27 33.3% 0049587 00495872 2/2   inked oxidoreductases                   
 928::1266 1.4e-24 24.6% 0042110 00421102 2/2   inked oxidoreductases                   
 927::1265 4.1e-24 27.9% 0050135 00501352 2/2   inked oxidoreductases                   
 960::1266 1.9e-21 28.6% 0047242 00472422 2/2   inked oxidoreductases                   
1013::1266 2.2e-20 31.4% 0049708 00497081 1/1   inked oxidoreductases                   
 102::359  3.7e-18 30.2% 0049601 00496011 1/1   minal nucleophile aminohydrolases (Ntn  
 960::1268 5.6e-14 25.8% 0047026 00470262 2/2   inked oxidoreductases                   
 102::357  7.3e-14 25.9% 0046519 00465191 1/1   minal nucleophile aminohydrolases (Ntn  
 923::1266 1.7e-11 25.4% 0046530 00465301 1/1   ne monophosphate dehydrogenase (IMPDH)  
 960::1268 3.1e-11 25.9% 0051899 00518991 1/1   inked oxidoreductases                   
 960::1200 2.2e-10 27.1% 0046721 00467211 1/1   inked oxidoreductases                   
 960::1261   3e-10 21.9% 0047561 00475611 1/1   ne monophosphate dehydrogenase (IMPDH)  
1033::1210 2.2e-09 28.9% 0039482 00394821 1/1   ase                                     
 153::336  7.6e-09 29.5% 0047031 00470311 1/1   minal nucleophile aminohydrolases (Ntn  
 237::675  7.4e-08 21.5% 0048029 00480291 1/2   inked oxidoreductases                   
  99::361  1.3e-06 22.7% 0039539 00395391 1/1   minal nucleophile aminohydrolases (Ntn  
1045::1204 1.5e-06 26.6% 0041152 00411521 1/1   ase                                     
 102::364  1.2e-05 24.7% 0050948 00509481 1/1   minal nucleophile aminohydrolases (Ntn  
 960::1265 1.8e-05 29.0% 0052481 00524811 1/1   inked oxidoreductases                   
 108::360  7.2e-05 26.9% 0046214 00462141 1/1   minal nucleophile aminohydrolases (Ntn  
1044::1211 0.00068 24.8% 0041658 00416581 1/1   ase                                     
 941::1204 0.00076 20.0% 0051569 00515691 1/1   ne monophosphate dehydrogenase (IMPDH)  
 565::680     0.37 20.6% 0049587 00495871 1/2   inked oxidoreductases                   
 552::665       12 21.7% 0047242 00472421 1/2   inked oxidoreductases                   
 603::680       12 23.0% 0050135 00501351 1/2   inked oxidoreductases                   
 603::679       16 20.3% 0042110 00421101 1/2   inked oxidoreductases                   
 603::679       16 23.0% 0047026 00470261 1/2   inked oxidoreductases                   
   1::1782


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSAEGVGDGAGVSLDLSLSFFRELTGDAALPAGRFGVGNFFLPQNPAFHGEAVGIIGNALKEQGFSVLLV
00465011   1/1  ----------------------------------------------------------------------
00479961   1/1  ----------------------------------------------------------------------
00405541   1/1  -----tgdGaGillqiPdeffrevlaelgielplagryavgmlflpkdeallelakklveelleeeglev
00368651   1/1  -----CGvgfiadldgkpshkivedaleaLvnlehRGavgadgktGdGaGillqiPdeffrevlaalgil
00465001   1/1  ----------------------------------------------------------------------
00479951   1/1  ----------------------------------------------------------------------
00480292   2/2  ----------------------------------------------------------------------
00495872   2/2  ----------------------------------------------------------------------
00421102   2/2  ----------------------------------------------------------------------
00501352   2/2  ----------------------------------------------------------------------
00472422   2/2  ----------------------------------------------------------------------
00497081   1/1  ----------------------------------------------------------------------
00496011   1/1  ----------------------------------------------------------------------
00470262   2/2  ----------------------------------------------------------------------
00465191   1/1  ----------------------------------------------------------------------
00465301   1/1  ----------------------------------------------------------------------
00518991   1/1  ----------------------------------------------------------------------
00467211   1/1  ----------------------------------------------------------------------
00475611   1/1  ----------------------------------------------------------------------
00394821   1/1  ----------------------------------------------------------------------
00470311   1/1  ----------------------------------------------------------------------
00480291   1/2  ----------------------------------------------------------------------
00395391   1/1  ----------------------------------------------------------------------
00411521   1/1  ----------------------------------------------------------------------
00509481   1/1  ----------------------------------------------------------------------
00524811   1/1  ----------------------------------------------------------------------
00462141   1/1  ----------------------------------------------------------------------
00416581   1/1  ----------------------------------------------------------------------
00515691   1/1  ----------------------------------------------------------------------
00495871   1/2  ----------------------------------------------------------------------
00472421   1/2  ----------------------------------------------------------------------
00501351   1/2  ----------------------------------------------------------------------
00421101   1/2  ----------------------------------------------------------------------
00470261   1/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           RDVPVNDTAIRPAAIPYQLPIRQWVFSAPVECATLAEFDWRIHKALLAIEALAYTVPDLAGFYPLSLSAR
00465011   1/1  ----------------------------------------------------------------------
00479961   1/1  ----------------------------------------------------------------------
00405541   1/1  lgwrevPvdssvlGelaletePlilqvfvaapdll.delelerklyvlrkriekal.....iddfyvlsl
00368651   1/1  pelgdyavgmlflpddelaalelakklleelllelglkvlgwrevpvdssvlGelaletePlilqvfval
00465001   1/1  ----------------------------------------------------------------------
00479951   1/1  ----------------------------------------------------------------------
00480292   2/2  ----------------------------------------------------------------------
00495872   2/2  ----------------------------------------------------------------------
00421102   2/2  ----------------------------------------------------------------------
00501352   2/2  ----------------------------------------------------------------------
00472422   2/2  ----------------------------------------------------------------------
00497081   1/1  ----------------------------------------------------------------------
00496011   1/1  -------------------------------CgilgivgnvltllllgllrleyRggltglnyDgaGiag
00470262   2/2  ----------------------------------------------------------------------
00465191   1/1  -------------------------------CgivGivglkdvlelllegllalehRGpdgaGiavydlg
00465301   1/1  ----------------------------------------------------------------------
00518991   1/1  ----------------------------------------------------------------------
00467211   1/1  ----------------------------------------------------------------------
00475611   1/1  ----------------------------------------------------------------------
00394821   1/1  ----------------------------------------------------------------------
00470311   1/1  ----------------------------------------------------------------------
00480291   1/2  ----------------------------------------------------------------------
00395391   1/1  ----------------------------lemCGiaGilgld......mlaalahrGPdssgiavldd...
00411521   1/1  ----------------------------------------------------------------------
00509481   1/1  -------------------------------CGivGivglkdvaellleglkalehRGpDsaGiavldgg
00524811   1/1  ----------------------------------------------------------------------
00462141   1/1  -------------------------------------mlmcGivgilgksllvadlllemlkalehRGpd
00416581   1/1  ----------------------------------------------------------------------
00515691   1/1  ----------------------------------------------------------------------
00495871   1/2  ----------------------------------------------------------------------
00472421   1/2  ----------------------------------------------------------------------
00501351   1/2  ----------------------------------------------------------------------
00421101   1/2  ----------------------------------------------------------------------
00470261   1/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           TQVLKGRLNSQEVMPYFCDLTDPRHKVHTMYFHTRFSTNTDPHPSMAQPFRLMAHNGELNTDKKNRLSEA
00465011   1/1  ----------------------------------------------------------------------
00479961   1/1  ----------------------------------------------------------------------
00405541   1/1  ssrtivyKglglpeqvsefyldllleelegslalgHvRfsTntfpswelaqPfralaHNGeintlrglrn
00368651   1/1  mcgivgil.lerelyvlrklilkal.qhrgqdsagiaslssrtivyKglglveqvfefyldllledlegs
00465001   1/1  ----------------------------------------------------------------------
00479951   1/1  ----------------------------------------------------------------------
00480292   2/2  ----------------------------------------------------------------------
00495872   2/2  ----------------------------------------------------------------------
00421102   2/2  ----------------------------------------------------------------------
00501352   2/2  ----------------------------------------------------------------------
00472422   2/2  ----------------------------------------------------------------------
00497081   1/1  ----------------------------------------------------------------------
00496011   1/1  l.dgkglrvykglglvadlf.lahrlpdlplkgnlglgHtRlatiglpslanaqPfvselpdgrlalvhN
00470262   2/2  ----------------------------------------------------------------------
00465191   1/1  gglrvfkdvglvadlanllslle...lkgnlgigHtRlathglpslenaqPflvdllgrlalvhNGeiyn
00465301   1/1  ----------------------------------------------------------------------
00518991   1/1  ----------------------------------------------------------------------
00467211   1/1  ----------------------------------------------------------------------
00475611   1/1  ----------------------------------------------------------------------
00394821   1/1  ----------------------------------------------------------------------
00470311   1/1  ------------vsdlfelllllplkgnvgigHtRlathglpslenaqPflsnslllgglalvhNGeiyn
00480291   1/2  ----------------------------------------------------------------------
00395391   1/1  ..........................ggvalghrrlaiid.lseagaqPllsevlklkdgrlvlvlnGei
00411521   1/1  ----------------------------------------------------------------------
00509481   1/1  glllvrkavglvsdlfllllle...klkgnlgigHtRlathglsslanahpfvsggialvhNGeiynyle
00524811   1/1  ----------------------------------------------------------------------
00462141   1/1  sagiavld...............................nlglghtRlstiglss..naqPfvsedgrla
00416581   1/1  ----------------------------------------------------------------------
00515691   1/1  ----------------------------------------------------------------------
00495871   1/2  ----------------------------------------------------------------------
00472421   1/2  ----------------------------------------------------------------------
00501351   1/2  ----------------------------------------------------------------------
00421101   1/2  ----------------------------------------------------------------------
00470261   1/2  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           AVALAKNASIVRPKGQSDSCRLDQTLQARVMEDGLDLVTAVVSMMPPAWENDDTLSPGVKSMLEYFSLYE
00465011   1/1  ----------------------------------------------------------------------
00479961   1/1  ----------------------------------------------------------------------
00405541   1/1  wleargylltsellsgddlekllPivneggsDsevldnllelllr.sglsleeallmlvPeawenidlmd
00368651   1/1  lalgHtRysTntlpswenaqPfralaHNGeinnllglrnwleargalftsellgddlekllPivneggsD
00465001   1/1  ----------------------------------------------------------------------
00479951   1/1  ----------------------------------------------------------------------
00480292   2/2  ----------------------------------------------------------------------
00495872   2/2  ----------------------------------------------------------------------
00421102   2/2  ----------------------------------------------------------------------
00501352   2/2  ----------------------------------------------------------------------
00472422   2/2  ----------------------------------------------------------------------
00497081   1/1  ----------------------------------------------------------------------
00496011   1/1  Geiynylelreelea............kgdsDtEvilhllellllegl......................
00470262   2/2  ----------------------------------------------------------------------
00465191   1/1  ylelreel......lealgyifvsdtDtEvilhlilelllellllplegldllealraalkrl.......
00465301   1/1  ----------------------------------------------------------------------
00518991   1/1  ----------------------------------------------------------------------
00467211   1/1  ----------------------------------------------------------------------
00475611   1/1  ----------------------------------------------------------------------
00394821   1/1  ----------------------------------------------------------------------
00470311   1/1  ylelreelealgy.......ifksdtDtEvilhliaellde............................d
00480291   1/2  --------------------------delllllglrllyllelllpelrqylsladleelafrrlprslf
00395391   1/1  yNylelraelglrfrtssDtevllal............................................
00411521   1/1  ----------------------------------------------------------------------
00509481   1/1  lreele.......elgyifksdtDtEvilhllaellle.gldlleavrkalk..................
00524811   1/1  ----------------------------------------------------------------------
00462141   1/1  lvhnGei....ynylelrkelek.gy...ifksdsDtevilhllallg......................
00416581   1/1  ----------------------------------------------------------------------
00515691   1/1  ----------------------------------------------------------------------
00495871   1/2  ----------------------------------------------------------------------
00472421   1/2  ----------------------------------------------------------------------
00501351   1/2  ----------------------------------------------------------------------
00421101   1/2  ----------------------------------------------------------------------
00470261   1/2  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           EKNDGPAALIFGDGTIIGARLDRLGLRPLRTVETDDYLCVMSEAGQIAFPAESVIRRGRIEAGGMLYYDH
00465011   1/1  ----------------------------------------------------------------------
00479961   1/1  ----------------------------------------------------------------------
00405541   1/1  lleelrafyeylslllepldGpaalvftdgdlvgaalDrnGlRPlrygvtkdgllvvASEvgvldivgae
00368651   1/1  sevldnllellvl.sglsleeavmmlvPeawqnidlmdeelrafyeylsalmepldGpfalvftdgdtlg
00465001   1/1  ----------------------------------------------------------------------
00479951   1/1  ----------------------------------------------------------------------
00480292   2/2  ----------------------------------------------------------------------
00495872   2/2  ----------------------------------------------------------------------
00421102   2/2  ----------------------------------------------------------------------
00501352   2/2  ----------------------------------------------------------------------
00472422   2/2  ----------------------------------------------------------------------
00497081   1/1  ----------------------------------------------------------------------
00496011   1/1  ....dlleamfaalelldgafalvdldgdkliaardr...rPlyygltddglvfaSelkallaltadvv.
00470262   2/2  ----------------------------------------------------------------------
00465191   1/1  ..................egafalallddggpllaardrlgirPlvygllltldgdgelvvASeplalla
00465301   1/1  ----------------------------------------------------------------------
00518991   1/1  ----------------------------------------------------------------------
00467211   1/1  ----------------------------------------------------------------------
00475611   1/1  ----------------------------------------------------------------------
00394821   1/1  ----------------------------------------------------------------------
00470311   1/1  llealkkalkrldGafalaildgdelilardrlgirPlvyglgdgelvfASElkal--------------
00480291   1/2  dyldggaddeltlgrnlaa.fddvllrp.rvlvdvddvdlsttilglklknPlvlapmgfgglsepieae
00395391   1/1  ...........yerwgldalrrlnGmFAfvlwdgdrlllarDrlGikPLyygvtdggllfaselkaLlal
00411521   1/1  ----------------------------------------------------------------------
00509481   1/1  .......rleGafalaildkdelllardargirPlvlglgdgelvfASelkallaltdlvrelepgelvv
00524811   1/1  ----------------------------------------------------------------------
00462141   1/1  ..............ldalkrldGmfafvlldlkgdklilarDrlgirPlyygldldgelvfaSelkalla
00416581   1/1  ----------------------------------------------------------------------
00515691   1/1  ----------------------------------------------------------------------
00495871   1/2  ----------------------------------------------------------------------
00472421   1/2  ----------------------------------------------------------------------
00501351   1/2  ----------------------------------------------------------------------
00421101   1/2  ----------------------------------------------------------------------
00470261   1/2  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           TERRAFSTVEALELLASRRDYSSLLSDARVMLGDLPEVPADKQGSPLRYNGDLERHQRYVAYSHNQESFK
00465011   1/1  ----------------------------llkledllellsllledlllddaellklqkafgyt..ledle
00479961   1/1  --------------------------------------------------ddeellrlqkafgytledle
00405541   1/1  vvrkgrlePGemvlvdleggrilldlei------------------------------------------
00368651   1/1  avldrnGlRPlrygltkdgllvvASEv-------------------------------------------
00465001   1/1  ----------------------------------------------------------------------
00479951   1/1  ----------------------------------------------------------------------
00480292   2/2  ----------------------------------------------------------------------
00495872   2/2  ----------------------------------------------------------------------
00421102   2/2  ----------------------------------------------------------------------
00501352   2/2  ----------------------------------------------------------------------
00472422   2/2  ----------------------------------------------------------------------
00497081   1/1  ----------------------------------------------------------------------
00496011   1/1  ..rlepgea-------------------------------------------------------------
00470262   2/2  ----------------------------------------------------------------------
00465191   1/1  lgfedvr---------------------------------------------------------------
00465301   1/1  ----------------------------------------------------------------------
00518991   1/1  ----------------------------------------------------------------------
00467211   1/1  ----------------------------------------------------------------------
00475611   1/1  ----------------------------------------------------------------------
00394821   1/1  ----------------------------------------------------------------------
00470311   1/1  ----------------------------------------------------------------------
00480291   1/2  ialaraaaelgggipiilgemgnvslerlaa.......................................
00395391   1/1  pgvllllgyvp-----------------------------------------------------------
00411521   1/1  ----------------------------------------------------------------------
00509481   1/1  itkdgvlildllge--------------------------------------------------------
00524811   1/1  ----------------------------------------------------------------------
00462141   1/1  lpdlvre...------------------------------------------------------------
00416581   1/1  ----------------------------------------------------------------------
00515691   1/1  ----------------------------------------------------------------------
00495871   1/2  ----------------------------------------------------------------------
00472421   1/2  ----------------------------------------------------------------------
00501351   1/2  ----------------------------------------------------------------------
00421101   1/2  ----------------------------------------------------------------------
00470261   1/2  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           FLMDPMLASGAEKISAMGYGNAINALSDQEGGVAKYFSQRFAQVTNPPLDSIREADGMTLRVALGAKPNS
00465011   1/1  llllplaesgkepvgsmGddtPlavLsdkprllydyfkqlfAqvtnPPiDplrEelvmslltllGpegnl
00479961   1/1  llllplaesgkepigsmGddtPlavLsdkprllydyFkqlfAqvTnPPiDplrEelvmslltllGpegnl
00405541   1/1  ----------------------------------------------------------------------
00368651   1/1  ----------------------------------------------------------------------
00465001   1/1  ----------------------------------------------------------------------
00479951   1/1  ----------------------------------------------------------------------
00480292   2/2  ----------------------------------------------------------------------
00495872   2/2  ----------------------------------------------------------------------
00421102   2/2  ----------------------------------------------------------------------
00501352   2/2  ----------------------------------------------------------------------
00472422   2/2  ----------------------------------------------------------------------
00497081   1/1  ----------------------------------------------------------------------
00496011   1/1  ----------------------------------------------------------------------
00470262   2/2  ----------------------------------------------------------------------
00465191   1/1  ----------------------------------------------------------------------
00465301   1/1  ----------------------------------------------------------------------
00518991   1/1  ----------------------------------------------------------------------
00467211   1/1  ----------------------------------------------------------------------
00475611   1/1  ----------------------------------------------------------------------
00394821   1/1  ----------------------------------------------------------------------
00470311   1/1  ----------------------------------------------------------------------
00480291   1/2  ........................avsgagglgsfglyalgdlevleellrrakaagikpigvnlgkpge
00395391   1/1  ----------------------------------------------------------------------
00411521   1/1  ----------------------------------------------------------------------
00509481   1/1  ----------------------------------------------------------------------
00524811   1/1  ----------------------------------------------------------------------
00462141   1/1  ----------------------------------------------------------------------
00416581   1/1  ----------------------------------------------------------------------
00515691   1/1  ----------------------------------------------------------------------
00495871   1/2  ----------------------------------------------------------------------
00472421   1/2  ----------------------------------------------------------------------
00501351   1/2  ----------------------------------------------------------------------
00421101   1/2  ----------------------------------------------------------------------
00470261   1/2  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           GAKKARQIVVRSPILTHLDMLRIREQPETPVRRFEMLYTPVFDAEDANEAALRQAIDGLCGEVVAFAAEE
00465011   1/1  leedeelarrlllesPvlsneelekllnldglkvltldllydvelgaeg.....leaalerlleeaeeav
00479961   1/1  leedeesarrlllesPvLsneeleklln......pglktltldllfdvelg.egleealdrlleeaeeav
00405541   1/1  ----------------------------------------------------------------------
00368651   1/1  ----------------------------------------------------------------------
00465001   1/1  ----------------------------------------------------------------------
00479951   1/1  ----------------------------------------------------------------------
00480292   2/2  ----------------------------------------------------------------------
00495872   2/2  ----------------------------------------------------------------------
00421102   2/2  ----------------------------------------------------------------------
00501352   2/2  ----------------------------------------------------------------------
00472422   2/2  ----------------------------------------------------------------------
00497081   1/1  ----------------------------------------------------------------------
00496011   1/1  ----------------------------------------------------------------------
00470262   2/2  ----------------------------------------------------------------------
00465191   1/1  ----------------------------------------------------------------------
00465301   1/1  ----------------------------------------------------------------------
00518991   1/1  ----------------------------------------------------------------------
00467211   1/1  ----------------------------------------------------------------------
00475611   1/1  ----------------------------------------------------------------------
00394821   1/1  ----------------------------------------------------------------------
00470311   1/1  ----------------------------------------------------------------------
00480291   1/2  ggalaaikvseagadaidlnlgaplvdpvvdvgsistlggdpelvledlkalreavg.vpvivKlvp...
00395391   1/1  ----------------------------------------------------------------------
00411521   1/1  ----------------------------------------------------------------------
00509481   1/1  ----------------------------------------------------------------------
00524811   1/1  ----------------------------------------------------------------------
00462141   1/1  ----------------------------------------------------------------------
00416581   1/1  ----------------------------------------------------------------------
00515691   1/1  ----------------------------------------------------------------------
00495871   1/2  ----------------------------------------------------------------------
00472421   1/2  -------------------------------------------------------------edarralea
00501351   1/2  ----------------------------------------------------------------------
00421101   1/2  ----------------------------------------------------------------------
00470261   1/2  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           GGIAVVTDRHVSAGRAALPMIMVVSAINQRLIEEGLRLRISLIVESGQFSSSHHIAAGLGFGASAVYPLG
00465011   1/1  rdganililsDrdlsedrlaipalLavgavhhhLireglrtkvslvvetgearevhhfavllGyGAdavn
00479961   1/1  regasilvLsdrllgelldedrlaipallavgavhhhLireglrtkvslvvetgearevhhfavllGyGA
00405541   1/1  ----------------------------------------------------------------------
00368651   1/1  ----------------------------------------------------------------------
00465001   1/1  ----------------------------------------------------------------------
00479951   1/1  ----------------------------------------------------------------------
00480292   2/2  ----------------------------------------------------------------------
00495872   2/2  ----------------------------------------------------------------------
00421102   2/2  ----------------------------------------------------------------------
00501352   2/2  ----------------------------------------------------------------------
00472422   2/2  ----------------------------------------------------------------------
00497081   1/1  ----------------------------------------------------------------------
00496011   1/1  ----------------------------------------------------------------------
00470262   2/2  ----------------------------------------------------------------------
00465191   1/1  ----------------------------------------------------------------------
00465301   1/1  ----------------------------------------------------------------------
00518991   1/1  ----------------------------------------------------------------------
00467211   1/1  ----------------------------------------------------------------------
00475611   1/1  ----------------------------------------------------------------------
00394821   1/1  ----------------------------------------------------------------------
00470311   1/1  ----------------------------------------------------------------------
00480291   1/2  ..tved..................AkaaeeaGaDaivvsgaGGtg..ldvgpptlealaevaealgelgl
00395391   1/1  ----------------------------------------------------------------------
00411521   1/1  ----------------------------------------------------------------------
00509481   1/1  ----------------------------------------------------------------------
00524811   1/1  ----------------------------------------------------------------------
00462141   1/1  ----------------------------------------------------------------------
00416581   1/1  ----------------------------------------------------------------------
00515691   1/1  ----------------------------------------------------------------------
00495871   1/2  ----vvsghggggldvgvptlealpevaeav.....ggdipviadGG.irtggDvakalalGAdaVmiGr
00472421   1/2  Gadaivvsghggggldvgiptlaalpevveav.......dvpviadGG.irtggdvakalalGAdaVlvG
00501351   1/2  ------------------------------------------viadGGirtgedaakalalGAdaVlvgr
00421101   1/2  ------------------------------------------viadGGirtggdvakalalGAdaVgiGr
00470261   1/2  ------------------------------------------viadGGIrtgedvakalalGAdgVlvGt


                         -         +         -         -         -         -         *:700
query           VQFRAEEKFGADADKAFKRFAKAAEKSLMKTMGKVGLCTAESYIGGEFFEPNFLDTSDPVLKRYFPNVKT
00465011   1/1  PylaletlldlleeglldgldleealknylkalekGllkimskmGistlasylgaqlfealgl..sllvv
00479961   1/1  davnPylaletlldlleeglleelleegkledldleeavlnyikalekgllkilskmgistlasylgaql
00405541   1/1  ----------------------------------------------------------------------
00368651   1/1  ----------------------------------------------------------------------
00465001   1/1  ----------------------------------------------------------------------
00479951   1/1  ----------------------------------------------------------------------
00480292   2/2  ----------------------------------------------------------------------
00495872   2/2  ----------------------------------------------------------------------
00421102   2/2  ----------------------------------------------------------------------
00501352   2/2  ----------------------------------------------------------------------
00472422   2/2  ----------------------------------------------------------------------
00497081   1/1  ----------------------------------------------------------------------
00496011   1/1  ----------------------------------------------------------------------
00470262   2/2  ----------------------------------------------------------------------
00465191   1/1  ----------------------------------------------------------------------
00465301   1/1  ----------------------------------------------------------------------
00518991   1/1  ----------------------------------------------------------------------
00467211   1/1  ----------------------------------------------------------------------
00475611   1/1  ----------------------------------------------------------------------
00394821   1/1  ----------------------------------------------------------------------
00470311   1/1  ----------------------------------------------------------------------
00480291   1/2  rgripvia.dGGirtgedaakalalGAdaVmvGraflgapea...-------------------------
00395391   1/1  ----------------------------------------------------------------------
00411521   1/1  ----------------------------------------------------------------------
00509481   1/1  ----------------------------------------------------------------------
00524811   1/1  ----------------------------------------------------------------------
00462141   1/1  ----------------------------------------------------------------------
00416581   1/1  ----------------------------------------------------------------------
00515691   1/1  ----------------------------------------------------------------------
00495871   1/2  aflyaleapge...egvknlleallgelrlamallGarsleelrgkllvl--------------------
00472421   1/2  taflyaleapgeegvknvleallgelrltmallGa-----------------------------------
00501351   1/2  allyale...aggegvpk.llealleelrlamallGarsleelrgrllll--------------------
00421101   1/2  aflyaleapge...egvvnvlellleelklamallGaksieelrgslll---------------------
00470261   1/2  aflyaleapge...egvkealealleelrltmallGapsieelrgkllv---------------------


                         -         -         -         -         +         -         -:770
query           PVGGVTFAVIAQAVADWHRKALSVKGENDIPLLGLFKERAEGAGHSYGTTAVRGFVDMTEEKIGFDKGTE
00465011   1/1  lllflgtlsrigglllheilrnypvlgrlrylle.sirlelggyfllrdlgelhfnrperilvlqrakg.
00479961   1/1  fealgl..slelvdllflgtasrilgigllllakeailrnypavg.rlryllevlglrqyrldgeehpfn
00405541   1/1  ----------------------------------------------------------------------
00368651   1/1  ----------------------------------------------------------------------
00465001   1/1  ----------------------------------------------------------------------
00479951   1/1  ----------------------------------------------------------------------
00480292   2/2  ----------------------------------------------------------------------
00495872   2/2  ----------------------------------------------------------------------
00421102   2/2  ----------------------------------------------------------------------
00501352   2/2  ----------------------------------------------------------------------
00472422   2/2  ----------------------------------------------------------------------
00497081   1/1  ----------------------------------------------------------------------
00496011   1/1  ----------------------------------------------------------------------
00470262   2/2  ----------------------------------------------------------------------
00465191   1/1  ----------------------------------------------------------------------
00465301   1/1  ----------------------------------------------------------------------
00518991   1/1  ----------------------------------------------------------------------
00467211   1/1  ----------------------------------------------------------------------
00475611   1/1  ----------------------------------------------------------------------
00394821   1/1  ----------------------------------------------------------------------
00470311   1/1  ----------------------------------------------------------------------
00480291   1/2  ----------------------------------------------------------------------
00395391   1/1  ----------------------------------------------------------------------
00411521   1/1  ----------------------------------------------------------------------
00509481   1/1  ----------------------------------------------------------------------
00524811   1/1  ----------------------------------------------------------------------
00462141   1/1  ----------------------------------------------------------------------
00416581   1/1  ----------------------------------------------------------------------
00515691   1/1  ----------------------------------------------------------------------
00495871   1/2  ----------------------------------------------------------------------
00472421   1/2  ----------------------------------------------------------------------
00501351   1/2  ----------------------------------------------------------------------
00421101   1/2  ----------------------------------------------------------------------
00470261   1/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           NEEALRLLPLNRLEDAFGLNDAAYYHNSFDRLTPDAIDAFEVTPGYRAFSRMMAEERARRPAALRDVLEL
00465011   1/1  ......................................................................
00479961   1/1  plersalqraak.vldyiafgaddev.........................................ytl
00405541   1/1  ----------------------------------------------------------------------
00368651   1/1  ----------------------------------------------------------------------
00465001   1/1  ----------------------------------------------------------------------
00479951   1/1  ----------------------------------------------------------------------
00480292   2/2  ----------------------------------------------------------------------
00495872   2/2  ----------------------------------------------------------------------
00421102   2/2  ----------------------------------------------------------------------
00501352   2/2  ----------------------------------------------------------------------
00472422   2/2  ----------------------------------------------------------------------
00497081   1/1  ----------------------------------------------------------------------
00496011   1/1  ----------------------------------------------------------------------
00470262   2/2  ----------------------------------------------------------------------
00465191   1/1  ----------------------------------------------------------------------
00465301   1/1  ----------------------------------------------------------------------
00518991   1/1  ----------------------------------------------------------------------
00467211   1/1  ----------------------------------------------------------------------
00475611   1/1  ----------------------------------------------------------------------
00394821   1/1  ----------------------------------------------------------------------
00470311   1/1  ----------------------------------------------------------------------
00480291   1/2  ----------------------------------------------------------------------
00395391   1/1  ----------------------------------------------------------------------
00411521   1/1  ----------------------------------------------------------------------
00509481   1/1  ----------------------------------------------------------------------
00524811   1/1  ----------------------------------------------------------------------
00462141   1/1  ----------------------------------------------------------------------
00416581   1/1  ----------------------------------------------------------------------
00515691   1/1  ----------------------------------------------------------------------
00495871   1/2  ----------------------------------------------------------------------
00472421   1/2  ----------------------------------------------------------------------
00501351   1/2  ----------------------------------------------------------------------
00421101   1/2  ----------------------------------------------------------------------
00470261   1/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:910
query           PADVTFAGSAEEFRREMGRFCRHGNNSFMVRGLRCDEAADGSFRLQLIGPHGHELARLAALGQSLLDRFD
00465011   1/1  ......................................................................
00479961   1/1  fdnylalnrslpprvlrdlldvdlstt...........................................
00405541   1/1  ----------------------------------------------------------------------
00368651   1/1  ----------------------------------------------------------------------
00465001   1/1  ----------------------------------------------------------------------
00479951   1/1  ----------------------------------------------------------------------
00480292   2/2  ----------------------------------------------------------------------
00495872   2/2  ----------------------------------------------------------------------
00421102   2/2  ----------------------------------------------------------------------
00501352   2/2  ----------------------------------------------------------------------
00472422   2/2  ----------------------------------------------------------------------
00497081   1/1  ----------------------------------------------------------------------
00496011   1/1  ----------------------------------------------------------------------
00470262   2/2  ----------------------------------------------------------------------
00465191   1/1  ----------------------------------------------------------------------
00465301   1/1  ----------------------------------------------------------------------
00518991   1/1  ----------------------------------------------------------------------
00467211   1/1  ----------------------------------------------------------------------
00475611   1/1  ----------------------------------------------------------------------
00394821   1/1  ----------------------------------------------------------------------
00470311   1/1  ----------------------------------------------------------------------
00480291   1/2  ----------------------------------------------------------------------
00395391   1/1  ----------------------------------------------------------------------
00411521   1/1  ----------------------------------------------------------------------
00509481   1/1  ----------------------------------------------------------------------
00524811   1/1  ----------------------------------------------------------------------
00462141   1/1  ----------------------------------------------------------------------
00416581   1/1  ----------------------------------------------------------------------
00515691   1/1  ----------------------------------------------------------------------
00495871   1/2  ----------------------------------------------------------------------
00472421   1/2  ----------------------------------------------------------------------
00501351   1/2  ----------------------------------------------------------------------
00421101   1/2  ----------------------------------------------------------------------
00470261   1/2  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:980
query           DDIAGHWLEGGALMVQAKGEAFAYMSLIRTAPNSIPLETVQKASEITKTLASGAMSHGALVAAAHEAVAH
00465011   1/1  .................agdeitfgenrllfddrillplrslldvslvdtsttigevelglklsaPiiia
00479961   1/1  .......................................................llgldevepplklsl
00405541   1/1  ----------------------------------------------------------------------
00368651   1/1  ----------------------------------------------------------------------
00465001   1/1  ----------------------------------------------------------------------
00479951   1/1  ----------------------------------------------------------------------
00480292   2/2  -------------------------------------------------delllllglrllyllelllpe
00495872   2/2  -------------------------------------------------liiapmggvtllspdgepala
00421102   2/2  -----------------nllafddillvpralpdvdlsevdlsttllglklslPliiapmtggtgllspe
00501352   2/2  ----------------rnllafddvllvprvlpevdvsdvdlsttllgltlknPliiapmgggtlsapag
00472422   2/2  -------------------------------------------------dllnladlealakrrlpkraf
00497081   1/1  ----------------------------------------------------------------------
00496011   1/1  ----------------------------------------------------------------------
00470262   2/2  -------------------------------------------------esllnladlealarrrlpkrk
00465191   1/1  ----------------------------------------------------------------------
00465301   1/1  ------------ltlrrnlltfddvllvprvltvlsl.dvdlsttltgllglkiPiiiapmggv.....a
00518991   1/1  -------------------------------------------------DlstellglklknPiglApmg
00467211   1/1  -------------------------------------------------alrrllrpllfylddevtlrl
00475611   1/1  -------------------------------------------------lvfdYldggagdeltlrrnrl
00394821   1/1  ----------------------------------------------------------------------
00470311   1/1  ----------------------------------------------------------------------
00480291   1/2  ----------------------------------------------------------------------
00395391   1/1  ----------------------------------------------------------------------
00411521   1/1  ----------------------------------------------------------------------
00509481   1/1  ----------------------------------------------------------------------
00524811   1/1  -------------------------------------------------lLsttllglklknPlglaagl
00462141   1/1  ----------------------------------------------------------------------
00416581   1/1  ----------------------------------------------------------------------
00515691   1/1  ------------------------------addeltlrrnrlaFddvllvprvltvldvsevdlstlllg
00495871   1/2  ----------------------------------------------------------------------
00472421   1/2  ----------------------------------------------------------------------
00501351   1/2  ----------------------------------------------------------------------
00421101   1/2  ----------------------------------------------------------------------
00470261   1/2  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:1050
query           GTNMVGGMSNSGEGGEHISRYGTIRASRIKQFASGRFGVWAGYLADPMLEEIEIKIGQGAKPGEGGQLPS
00465011   1/1  pMsfGalspeaeealaiaaaraGglgnlgegglspeelalrangagikslikqvasgrfGvrledlan..
00479961   1/1  PfiispMsfGalspeaeealaraaaraGglgntGegglsperlesledvvaaigdgyffqlyrlkdgdla
00405541   1/1  ----------------------------------------------------------------------
00368651   1/1  ----------------------------------------------------------------------
00465001   1/1  ----------------------------------------------------------------------
00479951   1/1  ----------------------------------------------------------------------
00480292   2/2  lrqylsladleelafrrlprslfdyldggaddeltlgrnlaafddvllrprvlvdvddvdlsttilglkl
00495872   2/2  raaaraGglgvlgsgslglee..evrkakpdgplivnlyaskdrgvlaelle..raeeagadaivltvds
00421102   2/2  gelalaraaaeagilgvlgslssllleeiaaellrvvrdaapdlpvfanlgvpgdteelle..aaeaaga
00501352   2/2  npalaraaaraGglgvigsgglgs..........leelaeairrvrd..lapggplgvnlggaqdaepgv
00472422   2/2  dyldggagdevtlrrnrlafddvllvprvlvdvsdvdlsttllglklslPlviapmagvtllhpdgeaal
00497081   1/1  --------------------------------lnlldlralalrrllrpllfyldgetahrltlaflrig
00496011   1/1  ----------------------------------------------------------------------
00470262   2/2  fdyldggagdevtlrrnrlafddvllvprvlpdvsdvdlsttllglklslPliiapmagvtllhpdgeaa
00465191   1/1  ----------------------------------------------------------------------
00465301   1/1  epelaiavakaGglgvlg.gglspeelaeeir.rvkelesgfinsplwfqlyllpfgvdlllellarata
00518991   1/1  vskdaeaiaalaagglGiielgtvtlapqegvtdprvrrlgaglinleglnnrglealll..elakaagi
00467211   1/1  nllafddilllprvlpdvsldvdlsttllgltlknPlvlapm.tvtdaelaialaalgaglivlgtvtve
00475611   1/1  afddvllvPrvltvldvsevdlstlllglglkiPiiiapmagvsepalaiaaakaGglgvlgaggstpee
00394821   1/1  ----------------------------------------------------leeklriaklllallidh
00470311   1/1  ----------------------------------------------------------------------
00480291   1/2  ----------------------------------------------------------------------
00395391   1/1  ----------------------------------------------------------------------
00411521   1/1  ----------------------------------------------------------------Gastte
00509481   1/1  ----------------------------------------------------------------------
00524811   1/1  vdkdaeailalaalgfgiielgtvtlapmagvtdprlrrl.........gagllnreglnndgleaalkl
00462141   1/1  ----------------------------------------------------------------------
00416581   1/1  ---------------------------------------------------------------llldllt
00515691   1/1  lglkiPiiiapMggvgeaalaaaaakaGglgvlgaggstpeeavaaaavkkal.................
00495871   1/2  ----------------------------------------------------------------------
00472421   1/2  ----------------------------------------------------------------------
00501351   1/2  ----------------------------------------------------------------------
00421101   1/2  ----------------------------------------------------------------------
00470261   1/2  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:1120
query           PKVTVEIAAARGGTPGVELVSPPPHHDTYSIEDLAQLIHDAKAARVRVIVKLVSSEGIGTIAVGVAKAGA
00465011   1/1  akaieiklgqgakpgeggllpgakvteaialirhlnagvdlisppghhdfysiedladliedlreatpgv
00479961   1/1  rslikqaasgrfGvnalvltn..vdaieiklgqgakpgrggvlpgvkvteaialarllnpgvdlisppgh
00405541   1/1  ----------------------------------------------------------------------
00368651   1/1  ----------------------------------------------------------------------
00465001   1/1  ----------------------------------------------------------------------
00479951   1/1  ----------------------------------------------------------------------
00480292   2/2  knPlvlapmgfgglsepieaeialaraaaelgggipiilgemgnvslerlaaavsgagglgsfglyalgd
00495872   2/2  pllgqrardlrggfllglkvtaeilalrlvppgealispahgdpilsledlkalrealg...vpvivkgv
00421102   2/2  dalvldvdapqegvrleglr....................dpslvlddikelkelv......pvpvivKg
00501352   2/2  eeaaraaeeagadalelnvdlpql.gsreldrprlllellealreavg...vpvivKlvggvltvedara
00472422   2/2  aiaaaeaGglgvlgtgssasie.......evkkaapgplivqlyvldretteellkraeaagadalvltv
00497081   1/1  llprvlvvsdvdlstellglklknPfglapmgdknlelaralaalgaglvvtgtvtpvpqegnpkprlfr
00496011   1/1  ----------------------------------------------------------------------
00470262   2/2  laraaaraGglgvlgsgslapee............evrkaapg..pfgvnlyglkdpellaellrraeaa
00465191   1/1  ----------------------------------------------------------------------
00465301   1/1  agikalvltpdapklglgrllvganvgvppdlaervealveagvdvivldtsagh....pelllelikrl
00518991   1/1  .kglplgvniggsgpeelaeaakllvrlleagadaielnigcpntgggaallldpelllelikalreavg
00467211   1/1  plegnvsprllrlpedeaiinlyglndpgl.eelle..rvkaagikipvganlgvdeilplgarvedfae
00475611   1/1  alaealvkralt.....................llplavklglgalpvaaavgagtavllraaalleagv
00394821   1/1  tllgppatseeireliaeaaklvkgfaavcvypgdvglaaellkgagllevkiatvigfplGgslldvkv
00470311   1/1  ----------------------------------------------------------------------
00480291   1/2  ----------------------------------------------------------------------
00395391   1/1  ----------------------------------------------------------------------
00411521   1/1  dkveeakaaveagadeieinishgnllegdlelllelikaikeavggvvvkvilgtvlldeeeivelaea
00509481   1/1  ----------------------------------------------------------------------
00524811   1/1  lrralkagkpglpvgvnlggnrpedlaeaarlleeagadailelnlgcp...ntlggsallkdpelllel
00462141   1/1  ----------------------------------------------------------------------
00416581   1/1  kalllllllllgrlllknillalsllelaklidltlLkpdateedieklcdeAleygfaavcvnpvfvkl
00515691   1/1  ................akkllggaapgalvdaaeravalleagadaividvahgvstslgwpdlkilrlk
00495871   1/2  ----------------------------------------------------------------------
00472421   1/2  ----------------------------------------------------------------------
00501351   1/2  ----------------------------------------------------------------------
00421101   1/2  ----------------------------------------------------------------------
00470261   1/2  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:1190
query           DVINVAGNTGGTGAAAVTSLKYTGRAAEIGIAEVHQALCATGLRAKVLLRCSGAHQTASDVVKSALLGGD
00465011   1/1  pvivKlvggvgtvedAalaakaGaDaivvsGheGGTgaaplrsldgaglptllalaevadalvenglrdr
00479961   1/1  hdfyspedllelierlreatpgvpvivKlvagvgigtdAaaaaeaGaDaivvsGheGGTGaaplrsldga
00405541   1/1  ----------------------------------------------------------------------
00368651   1/1  ----------------------------------------------------------------------
00465001   1/1  ----------------------------------------------------------------------
00479951   1/1  ----------------------------------------------------------------------
00480292   2/2  levleellr..rakaagikpigvnlgkpgeggalaaikvseagadaidlnlgaplvdpvvdvgsistlgg
00495872   2/2  ltv...edallaaeaGadaivvsghggggl........dvgvptlealpevaeav.....ggdipviadG
00421102   2/2  vgnvltvedalllaeaGadaivvsghgGrqldavevarsicttrlvagvglptltallevaeavggipvi
00501352   2/2  lleaGadaivvsgggggghidvetlravgaattggllgvgvptlallaevreal.....g.dipviadGG
00472422   2/2  dapllgirerdlrlgfglppglgglntldlvvipegrllg..advilldaahgdplllleliealrealg
00497081   1/1  lpedealinlyglnnegldallerlkalkallllllleaggplivqiggsglfgsrpedlaeaaellepl
00496011   1/1  ----------------------------------------------------------------------
00470262   2/2  gadaivltvglpvlgvrerdlrlgfllppaaggalladlaralalvlagadelvlvvs..dgdpegllel
00465191   1/1  ----------------------------------------------------------------------
00465301   1/1  keatpgvpviakgvat...vedAlaaveaGaDaivvggggGggltgrev..lgvgvptltalpevadavk
00518991   1/1  ipvivKirpgidtaedveiakaleeaGladaiivsnrtggtlaadigpgsllttrlvehgglsgdalppl
00467211   1/1  aarlaeegadaielnfssPnlpnlrsdeyggslenrprllleiikavreavgedvpvivKlspgldvedi
00475611   1/1  dvividvapgsdpsllwdllaikrl..kpkgpvvvkgvatved...AkkaeeaGaDaivvsgggggghtg
00394821   1/1  aeaeaaveaGadeidlvinlgallsgdpeevleeiravveaakdlgvpvkviletglltdveflveaara
00470311   1/1  ----------------------------------------------------------------------
00480291   1/2  ----------------------------------------------------------------------
00395391   1/1  ----------------------------------------------------------------------
00411521   1/1  lieaGaDgikvsgGfggi.................gatlealrliaevvkekipiiadGGIrsgedalka
00509481   1/1  ----------------------------------------------------------------------
00524811   1/1  leavkeavdvpvivKispgvgiediediakalveaGadaivvsntthggrqldiegvdlivaqgpeaggl
00462141   1/1  ----------------------------------------------------------------------
00416581   1/1  akellkgsdvkvatvigFPlGgstlevklaeaklaieaGadeidlvinigallggdpelvyeeikavrea
00515691   1/1  pvgpivaggvltv...edArkaveaGaDaivvsghgggghtgrea........tgvglpqitavalvaaa
00495871   1/2  ----------------------------------------------------------------------
00472421   1/2  ----------------------------------------------------------------------
00501351   1/2  ----------------------------------------------------------------------
00421101   1/2  ----------------------------------------------------------------------
00470261   1/2  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:1260
query           SFEFGTTALMMLKCVMAKNCNIKCPAGLTTNQEAFNGDPRALAQYLMNIAHETREILAGLGLRSLREARG
00465011   1/1  ipviadGGirtgrdvakalalGAdavgiGraflvalgcimarkchlntcpvgvatqdpelrerlvggaeg
00479961   1/1  GlptilalaevadalvenglrdripviadGGirtgrdvakalalGAdavgiGraflyalgcimarkchln
00405541   1/1  ----------------------------------------------------------------------
00368651   1/1  ----------------------------------------------------------------------
00465001   1/1  ----------------------------------------------------------------------
00479951   1/1  ----------------------------------------------------------------------
00480292   2/2  dpelvledlkal...reavgvpvivKlvp...tvedAkaaeeaGaDaivvsg.aGGtg.......ldvgp
00495872   2/2  GirtggDvakalalGAdaVmiGraflyaleapge......................egvknlleallgel
00421102   2/2  adGGirtggdvakalalGAdaVgiGraflyaleapge......................egvvnvlelll
00501352   2/2  irtgedaakalalGAdaVlvgrallyalea.......................ggegvpkllealleelr
00472422   2/2  ...vpvivkgvatv...edarraleaGadaivvsghggggl........dvgiptlaalpevveav....
00497081   1/1  adaielnlscPakpglggllgaalledfiaaarraveagadiielgiasgylldgfliplanlraleyGn
00496011   1/1  ----------------------------------------------------------------------
00470262   2/2  iealreatg...vpvivkgvatved...araaaeaGadaivvsggggggl........dvgvptlealpe
00465191   1/1  ----------------------------------------------------------------------
00465301   1/1  ....grdipviadGGIrtggdvakalalGAdaVmiGtaflgtleapgeevykdgvltklyrgmpsrgamn
00518991   1/1  alellaevaeavgdipviadGGIrsgedaakalalGAdaVmiGrafly......................
00467211   1/1  edlakaleea------------------------------------------------------------
00475611   1/1  rlstgvllpq......ivavrlvaeaavgvdipviadGGIrtggdvakAlalGAdaVmvGtaflatleap
00394821   1/1  aaeaGAdfikvsd..Gg...--------------------------------------------------
00470311   1/1  ----------------------------------------------------------------------
00480291   1/2  ----------------------------------------------------------------------
00395391   1/1  ----------------------------------------------------------------------
00411521   1/1  laaGAdlvgvgsal--------------------------------------------------------
00509481   1/1  ----------------------------------------------------------------------
00524811   1/1  sGnalapaaleliaeiadavk.....gdipviadGGIrsgedaakalalGAdaVmiGrafly........
00462141   1/1  ----------------------------------------------------------------------
00416581   1/1  cgpvvvKviletgdldleeiv-------------------------------------------------
00515691   1/1  avgvdipviadGGI--------------------------------------------------------
00495871   1/2  ----------------------------------------------------------------------
00472421   1/2  ----------------------------------------------------------------------
00501351   1/2  ----------------------------------------------------------------------
00421101   1/2  ----------------------------------------------------------------------
00470261   1/2  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:1330
query           RSDLLHLLDHPASVGQLDLRAMLAVVEEVKIDNPVYMEKDFALDDAFIELVRSALVDSRRENIELGGNRF
00465011   1/1  vanylrala-------------------------------------------------------------
00479961   1/1  tcpvgvatq-------------------------------------------------------------
00405541   1/1  ----------------------------------------------------------------------
00368651   1/1  ----------------------------------------------------------------------
00465001   1/1  ----------------------------------ldldldglldrellellleaiekgekvlllld....
00479951   1/1  ----------------------------------------------------------------------
00480292   2/2  ptle------------------------------------------------------------------
00495872   2/2  rlama-----------------------------------------------------------------
00421102   2/2  eelkla----------------------------------------------------------------
00501352   2/2  lamal-----------------------------------------------------------------
00472422   2/2  ...dvp----------------------------------------------------------------
00497081   1/1  dpelll----------------------------------------------------------------
00496011   1/1  ----------------------------------------------------------------------
00470262   2/2  vaeav...--------------------------------------------------------------
00465191   1/1  ----------------------------------------------------------------------
00465301   1/1  rlsldv----------------------------------------------------------------
00518991   1/1  ....ggpa--------------------------------------------------------------
00467211   1/1  ----------------------------------------------------------------------
00475611   1/1  g---------------------------------------------------------------------
00394821   1/1  ----------------------------------------------------------------------
00470311   1/1  ----------------------------------------------------------------------
00480291   1/2  ----------------------------------------------------------------------
00395391   1/1  ----------------------------------------------------------------------
00411521   1/1  ----------------------------------------------------------------------
00509481   1/1  ----------------------------------------------------------------------
00524811   1/1  .....-----------------------------------------------------------------
00462141   1/1  ----------------------------------------------------------------------
00416581   1/1  ----------------------------------------------------------------------
00515691   1/1  ----------------------------------------------------------------------
00495871   1/2  ----------------------------------------------------------------------
00472421   1/2  ----------------------------------------------------------------------
00501351   1/2  ----------------------------------------------------------------------
00421101   1/2  ----------------------------------------------------------------------
00470261   1/2  ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:1400
query           LNNCNKSVGGQLAVDIERMLNHELSDEQLDALPAVKRDSRGRRFLEAGSVRIDTSGSAGQSFGAFCNDGM
00465011   1/1  ----------------------------------------------------------------------
00479961   1/1  ----------------------------------------------------------------------
00405541   1/1  ----------------------------------------------------------------------
00368651   1/1  ----------------------------------------------------------------------
00465001   1/1  ivnvdravgallsgeiakry....................griglpddtititveGsaGqslGaflakgl
00479951   1/1  ----------eldldldgllddellelileaiedlelvllnlkilntdrfvgarlsgeiakrygaaglp.
00480292   2/2  ----------------------------------------------------------------------
00495872   2/2  ----------------------------------------------------------------------
00421102   2/2  ----------------------------------------------------------------------
00501352   2/2  ----------------------------------------------------------------------
00472422   2/2  ----------------------------------------------------------------------
00497081   1/1  ----------------------------------------------------------------------
00496011   1/1  ----------------------------------------------------------------------
00470262   2/2  ----------------------------------------------------------------------
00465191   1/1  ----------------------------------------------------------------------
00465301   1/1  ----------------------------------------------------------------------
00518991   1/1  ----------------------------------------------------------------------
00467211   1/1  ----------------------------------------------------------------------
00475611   1/1  ----------------------------------------------------------------------
00394821   1/1  ----------------------------------------------------------------------
00470311   1/1  ----------------------------------------------------------------------
00480291   1/2  ----------------------------------------------------------------------
00395391   1/1  ----------------------------------------------------------------------
00411521   1/1  ----------------------------------------------------------------------
00509481   1/1  ----------------------------------------------------------------------
00524811   1/1  ----------------------------------------------------------------------
00462141   1/1  ----------------------------------------------------------------------
00416581   1/1  ----------------------------------------------------------------------
00515691   1/1  ----------------------------------------------------------------------
00495871   1/2  ----------------------------------------------------------------------
00472421   1/2  ----------------------------------------------------------------------
00501351   1/2  ----------------------------------------------------------------------
00421101   1/2  ----------------------------------------------------------------------
00470261   1/2  ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:1470
query           IMVHTGTCNDGVGKSACGGTIVVRSPGGGSKETGGNVLVGNFALFGATGGRTFVEGQAGDRFAVRNSGAT
00465011   1/1  ----------------------------------------------------------------------
00479961   1/1  ----------------------------------------------------------------------
00405541   1/1  ----------------------------------------------------------------------
00368651   1/1  ----------------------------------------------------------------------
00465001   1/1  tleveGdAndyvGkgmsgGkivvlgnagdsfvalgnvivGnvalygatgGklfvrGnAGerfgvrnsgat
00479951   1/1  gtititleGsaGqslGaflakgltltveGdandyvGkgmsgGkivvlgnagdllgaeenviiGnvvlyga
00480292   2/2  ----------------------------------------------------------------------
00495872   2/2  ----------------------------------------------------------------------
00421102   2/2  ----------------------------------------------------------------------
00501352   2/2  ----------------------------------------------------------------------
00472422   2/2  ----------------------------------------------------------------------
00497081   1/1  ----------------------------------------------------------------------
00496011   1/1  ----------------------------------------------------------------------
00470262   2/2  ----------------------------------------------------------------------
00465191   1/1  ----------------------------------------------------------------------
00465301   1/1  ----------------------------------------------------------------------
00518991   1/1  ----------------------------------------------------------------------
00467211   1/1  ----------------------------------------------------------------------
00475611   1/1  ----------------------------------------------------------------------
00394821   1/1  ----------------------------------------------------------------------
00470311   1/1  ----------------------------------------------------------------------
00480291   1/2  ----------------------------------------------------------------------
00395391   1/1  ----------------------------------------------------------------------
00411521   1/1  ----------------------------------------------------------------------
00509481   1/1  ----------------------------------------------------------------------
00524811   1/1  ----------------------------------------------------------------------
00462141   1/1  ----------------------------------------------------------------------
00416581   1/1  ----------------------------------------------------------------------
00515691   1/1  ----------------------------------------------------------------------
00495871   1/2  ----------------------------------------------------------------------
00472421   1/2  ----------------------------------------------------------------------
00501351   1/2  ----------------------------------------------------------------------
00421101   1/2  ----------------------------------------------------------------------
00470261   1/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:1540
query           AVVEGVGDFACEYMTNGAVLNLGSFGKGFGNGMSGGFVYQYDPYGDLPKKVSHDSILLGSITGEDEQAAI
00465011   1/1  ----------------------------------------------------------------------
00479961   1/1  ----------------------------------------------------------------------
00405541   1/1  ----------------------------------------------------------------------
00368651   1/1  ----------------------------------------------------------------------
00465001   1/1  ivveGvgdhlceymtgGtvvvlGdtgrnfgagmtgGviyvlgevgsllprlnlelvvllrvldee.....
00479951   1/1  tgGklfvrGnAGerfgvrnsgativveGvgdhlceymtgGtvvvlGdtgrnfgagmtgGviyvldevgsl
00480292   2/2  ----------------------------------------------------------------------
00495872   2/2  ----------------------------------------------------------------------
00421102   2/2  ----------------------------------------------------------------------
00501352   2/2  ----------------------------------------------------------------------
00472422   2/2  ----------------------------------------------------------------------
00497081   1/1  ----------------------------------------------------------------------
00496011   1/1  ----------------------------------------------------------------------
00470262   2/2  ----------------------------------------------------------------------
00465191   1/1  ----------------------------------------------------------------------
00465301   1/1  ----------------------------------------------------------------------
00518991   1/1  ----------------------------------------------------------------------
00467211   1/1  ----------------------------------------------------------------------
00475611   1/1  ----------------------------------------------------------------------
00394821   1/1  ----------------------------------------------------------------------
00470311   1/1  ----------------------------------------------------------------------
00480291   1/2  ----------------------------------------------------------------------
00395391   1/1  ----------------------------------------------------------------------
00411521   1/1  ----------------------------------------------------------------------
00509481   1/1  ----------------------------------------------------------------------
00524811   1/1  ----------------------------------------------------------------------
00462141   1/1  ----------------------------------------------------------------------
00416581   1/1  ----------------------------------------------------------------------
00515691   1/1  ----------------------------------------------------------------------
00495871   1/2  ----------------------------------------------------------------------
00472421   1/2  ----------------------------------------------------------------------
00501351   1/2  ----------------------------------------------------------------------
00421101   1/2  ----------------------------------------------------------------------
00470261   1/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:1610
query           HNQAVHQLLTLHVAETGSAKAAWLLENWESEQHNFAYGMPRALLLYQDSDEILKAKPRKELLEELASALA
00465011   1/1  ----------------------------------------------------------------------
00479961   1/1  ----------------------------------------------------------------------
00405541   1/1  ----------------------------------------------------------------------
00368651   1/1  ----------------------------------------------------------------------
00465001   1/1  dlallkelleehleltgselaalildnwelllskfvkvvPkdykrvlelllel-----------------
00479951   1/1  lprlnlelvvllrvldee.....dlellkelleehleltgselaaeil----------------------
00480292   2/2  ----------------------------------------------------------------------
00495872   2/2  ----------------------------------------------------------------------
00421102   2/2  ----------------------------------------------------------------------
00501352   2/2  ----------------------------------------------------------------------
00472422   2/2  ----------------------------------------------------------------------
00497081   1/1  ----------------------------------------------------------------------
00496011   1/1  ----------------------------------------------------------------------
00470262   2/2  ----------------------------------------------------------------------
00465191   1/1  ----------------------------------------------------------------------
00465301   1/1  ----------------------------------------------------------------------
00518991   1/1  ----------------------------------------------------------------------
00467211   1/1  ----------------------------------------------------------------------
00475611   1/1  ----------------------------------------------------------------------
00394821   1/1  ----------------------------------------------------------------------
00470311   1/1  ----------------------------------------------------------------------
00480291   1/2  ----------------------------------------------------------------------
00395391   1/1  ----------------------------------------------------------------------
00411521   1/1  ----------------------------------------------------------------------
00509481   1/1  ----------------------------------------------------------------------
00524811   1/1  ----------------------------------------------------------------------
00462141   1/1  ----------------------------------------------------------------------
00416581   1/1  ----------------------------------------------------------------------
00515691   1/1  ----------------------------------------------------------------------
00495871   1/2  ----------------------------------------------------------------------
00472421   1/2  ----------------------------------------------------------------------
00501351   1/2  ----------------------------------------------------------------------
00421101   1/2  ----------------------------------------------------------------------
00470261   1/2  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:1680
query           GYQLRKFKLAYRDRKAVLNGTVPGYGETDTEDMYALINNYTVLSMAQAIALQRLPMASGPSDPAIEKAVR
00465011   1/1  ----------------------------------------------------------------------
00479961   1/1  ----------------------------------------------------------------------
00405541   1/1  ----------------------------------------------------------------------
00368651   1/1  ----------------------------------------------------------------------
00465001   1/1  ----------------------------------------------------------------------
00479951   1/1  ----------------------------------------------------------------------
00480292   2/2  ----------------------------------------------------------------------
00495872   2/2  ----------------------------------------------------------------------
00421102   2/2  ----------------------------------------------------------------------
00501352   2/2  ----------------------------------------------------------------------
00472422   2/2  ----------------------------------------------------------------------
00497081   1/1  ----------------------------------------------------------------------
00496011   1/1  ----------------------------------------------------------------------
00470262   2/2  ----------------------------------------------------------------------
00465191   1/1  ----------------------------------------------------------------------
00465301   1/1  ----------------------------------------------------------------------
00518991   1/1  ----------------------------------------------------------------------
00467211   1/1  ----------------------------------------------------------------------
00475611   1/1  ----------------------------------------------------------------------
00394821   1/1  ----------------------------------------------------------------------
00470311   1/1  ----------------------------------------------------------------------
00480291   1/2  ----------------------------------------------------------------------
00395391   1/1  ----------------------------------------------------------------------
00411521   1/1  ----------------------------------------------------------------------
00509481   1/1  ----------------------------------------------------------------------
00524811   1/1  ----------------------------------------------------------------------
00462141   1/1  ----------------------------------------------------------------------
00416581   1/1  ----------------------------------------------------------------------
00515691   1/1  ----------------------------------------------------------------------
00495871   1/2  ----------------------------------------------------------------------
00472421   1/2  ----------------------------------------------------------------------
00501351   1/2  ----------------------------------------------------------------------
00421101   1/2  ----------------------------------------------------------------------
00470261   1/2  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:1750
query           NLILTEDYALMQRLLKYAREALSDHSDQQLAVMIAAKRLDDYKQALARRNIWSVDSPGTYGWIIQQNRKN
00465011   1/1  ----------------------------------------------------------------------
00479961   1/1  ----------------------------------------------------------------------
00405541   1/1  ----------------------------------------------------------------------
00368651   1/1  ----------------------------------------------------------------------
00465001   1/1  ----------------------------------------------------------------------
00479951   1/1  ----------------------------------------------------------------------
00480292   2/2  ----------------------------------------------------------------------
00495872   2/2  ----------------------------------------------------------------------
00421102   2/2  ----------------------------------------------------------------------
00501352   2/2  ----------------------------------------------------------------------
00472422   2/2  ----------------------------------------------------------------------
00497081   1/1  ----------------------------------------------------------------------
00496011   1/1  ----------------------------------------------------------------------
00470262   2/2  ----------------------------------------------------------------------
00465191   1/1  ----------------------------------------------------------------------
00465301   1/1  ----------------------------------------------------------------------
00518991   1/1  ----------------------------------------------------------------------
00467211   1/1  ----------------------------------------------------------------------
00475611   1/1  ----------------------------------------------------------------------
00394821   1/1  ----------------------------------------------------------------------
00470311   1/1  ----------------------------------------------------------------------
00480291   1/2  ----------------------------------------------------------------------
00395391   1/1  ----------------------------------------------------------------------
00411521   1/1  ----------------------------------------------------------------------
00509481   1/1  ----------------------------------------------------------------------
00524811   1/1  ----------------------------------------------------------------------
00462141   1/1  ----------------------------------------------------------------------
00416581   1/1  ----------------------------------------------------------------------
00515691   1/1  ----------------------------------------------------------------------
00495871   1/2  ----------------------------------------------------------------------
00472421   1/2  ----------------------------------------------------------------------
00501351   1/2  ----------------------------------------------------------------------
00421101   1/2  ----------------------------------------------------------------------
00470261   1/2  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:1820
query           IEKIGRLPGFEELFAARAIPDLATASSHSRAA--------------------------------------
00465011   1/1  ----------------------------------------------------------------------
00479961   1/1  ----------------------------------------------------------------------
00405541   1/1  ----------------------------------------------------------------------
00368651   1/1  ----------------------------------------------------------------------
00465001   1/1  ----------------------------------------------------------------------
00479951   1/1  ----------------------------------------------------------------------
00480292   2/2  ----------------------------------------------------------------------
00495872   2/2  ----------------------------------------------------------------------
00421102   2/2  ----------------------------------------------------------------------
00501352   2/2  ----------------------------------------------------------------------
00472422   2/2  ----------------------------------------------------------------------
00497081   1/1  ----------------------------------------------------------------------
00496011   1/1  ----------------------------------------------------------------------
00470262   2/2  ----------------------------------------------------------------------
00465191   1/1  ----------------------------------------------------------------------
00465301   1/1  ----------------------------------------------------------------------
00518991   1/1  ----------------------------------------------------------------------
00467211   1/1  ----------------------------------------------------------------------
00475611   1/1  ----------------------------------------------------------------------
00394821   1/1  ----------------------------------------------------------------------
00470311   1/1  ----------------------------------------------------------------------
00480291   1/2  ----------------------------------------------------------------------
00395391   1/1  ----------------------------------------------------------------------
00411521   1/1  ----------------------------------------------------------------------
00509481   1/1  ----------------------------------------------------------------------
00524811   1/1  ----------------------------------------------------------------------
00462141   1/1  ----------------------------------------------------------------------
00416581   1/1  ----------------------------------------------------------------------
00515691   1/1  ----------------------------------------------------------------------
00495871   1/2  ----------------------------------------------------------------------
00472421   1/2  ----------------------------------------------------------------------
00501351   1/2  ----------------------------------------------------------------------
00421101   1/2  ----------------------------------------------------------------------
00470261   1/2  ----------------------------------------------------------------------