[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for atum0:AAK86181.1


[Show Plain Result]

## Summary of Sequence Search
   1::299
   2::300  4.4e-70 36.5% 0052784 00527841 1/1   inase-like                              
   2::299  2.3e-69 36.6% 0043278 00432781 1/1   inase-like                              
   1::294  1.2e-68 35.8% 0046332 00463321 1/1   inase-like                              
   2::300  1.2e-67 38.9% 0051760 00517601 1/1   inase-like                              
   2::299  4.1e-66 36.5% 0052553 00525531 1/1   inase-like                              
   1::299  4.9e-66 37.0% 0051741 00517411 1/1   inase-like                              
   2::294  1.1e-65 34.9% 0046030 00460301 1/1   inase-like                              
   1::299  2.2e-65 37.7% 0050248 00502481 1/1   inase-like                              
   2::300  5.7e-65 36.5% 0044587 00445871 1/1   inase-like                              
   1::299  8.3e-64 35.0% 0052420 00524201 1/1   inase-like                              
   2::300  5.8e-55 35.6% 0049742 00497421 1/1   inase-like                              
   1::296  4.8e-53 38.2% 0050218 00502181 1/1   inase-like                              
   1::301  2.6e-51 32.3% 0051780 00517801 1/1   inase-like                              
  23::300  4.2e-37 32.2% 0040500 00405001 1/1   inase-like                              
  10::295  2.5e-32 33.6% 0049846 00498461 1/1   inase-like                              
  81::286  4.6e-31 33.3% 0046577 00465771 1/1   inase-like                              
   9::301  1.3e-30 30.6% 0050193 00501931 1/1   inase-like                              
   8::299  2.8e-30 29.1% 0047705 00477051 1/1   inase-like                              
  75::290  2.9e-28 31.0% 0044661 00446611 1/1   inase-like                              
   2::290  1.1e-25 23.2% 0047908 00479081 1/1   inase-like                              
  32::299  6.6e-20 25.0% 0051846 00518461 1/1   inase-like                              
   1::299


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MITVFGSINMDLVATAKRLPKPGETVTGDTFSTAAGGKGANQALAARRAGVTVKMAGATGDDTFAAPALT
00527841   1/1  -mlkvlviGnallDliltvdelplpgevlrvgsfelvpGGagaNvavalarlgadvaligavGdDafgdf
00432781   1/1  -mmkvlvvGnallDliltvdslpapgevvlviagsvsaGGaganvavalarlgadvaligavGdDefgqa
00463321   1/1  MkmldilviGealvDliatvddefleklglkkgsailiseerlpllgel.lagsfrlvpGGaaaNvaval
00517601   1/1  -mkmldvlviGealvDlv.....ppapgelllatsfekgpGGaaaNvAvalarlgldvafigavgdDafg
00525531   1/1  -mivtvtgnpalDlilrldrlp.lgetvrvgsfrkspGGkgaNvAvalarlGadvaligavGdd.fgdfl
00517411   1/1  mkvlviGnallDlilrvdrlp.pgetvrvgsfrlvpGGagaNvavalarlgadvaligavGdd.fgdfll
00460301   1/1  -mkklkvlviGealvDliatvddefleklglkkglmilideerlpelgetllagsfelvpGGsaaNvava
00502481   1/1  kmmkvlviGnallDliltvdslpapgevvraesfrlrpGGkaanvavalarlgadlvallgavGdDsfgd
00445871   1/1  -mldvlviGeallDlia.....papgelvrvesfrlvpGGkaaNvAvalarlGadvalvgavGdDefgdf
00524201   1/1  MkilviGeallDlil.....peagellralslelrpGGsaanvavalarlgakvaligavGdDefgdfll
00497421   1/1  -kdvlviGeallDliltvdg...........slrlrpGGaaanvavalarlgadvallgavGdDafgdfl
00502181   1/1  llllkmlkilvvGnaliDlivtvd............sflkalGGsaanvavalarlglkvaligavGdde
00517801   1/1  mkilvvGnllvDiilvvdrlplegetllleasslkvspGGnalnvAvalarlglrvslvgavGnD.aGkl
00405001   1/1  ----------------------mprvLtiagsdssGgaGinaalkalaalGvd.................
00498461   1/1  ---------mgrvlvigg..............sdsgGgaginaalkalaalgvdvtlv............
00465771   1/1  ----------------------------------------------------------------------
00501931   1/1  --------kmprvlviag..............sdpgGgagnqAdlkalaalgvdvaav............
00477051   1/1  -------gtmprvlviggsd..............pgGgagnqAdlkalaalgvyvtav............
00446611   1/1  ----------------------------------------------------------------------
00479081   1/1  -lllllllellllllpvrdldshKgsfGrvlviaGsdgygGAailaalaalraga...............
00518461   1/1  -------------------------------sdgygGAailaalaalrlGaglvtvaalgga........


                         -         -         *         -         -         -         -:140
query           LLRDAGTDLSLVKTAPGPTGTAVILIGEGGENMISVIPAANGEVSAFDATKVVGEMDAGDILMLQFEIPA
00527841   1/1  llelleeegvdtslvlvdpgaptglalilvdpdgertiifylgaaalltpedldallelladadvvvlsg
00432781   1/1  llktlqalgvdtsfvrvdegaptglalvlldadgertilaylgaaaellpelldallellkgadavvlgg
00463321   1/1  arlldeGakvaligavGdDafgdfllelleaegvdtslvvvpgrpTglalilvd.dgertfvfylgaaal
00517601   1/1  dfllealreegvdtslvlrdpgptglalilvdadgersivfylreggaaallspddld..lelllagadv
00525531   1/1  lellkkegvdtsfvrvdggtrtgvalvvtddgertilvlpgasaalllelldlllellkdadvlvlsgsl
00517411   1/1  elleeegvdtsfvvv.pgptglalvlvd..gertilvydgaaaaalllelldlllellkdadavvlggyl
00460301   1/1  larllgldgakvafigavGdDefgdfllellkkegvdtslvvvdegtttglalilvd.gertivtylgas
00502481   1/1  allellealgvdtslv.r.daptglalilvdadgertivvylgaaaeltpedld..lallaaadivvlsg
00445871   1/1  llellreegvdtsfvrvdggptglalilvdpdgertivfyrgpgaallltpedldll..llagadlvhls
00524201   1/1  ellkkegvdtslvlvdegrptglaliellvdadgertivtylggsaaaeltpedld..lellkdadavvl
00497421   1/1  lellegagvdtdlvtvdpgrptglalilvdadgertvvfylgasadlllldllld..lledadvvvlsgg
00502181   1/1  fge.l.dllrelgvdtslv..pggptglalvlldedgertivlylgan.....llldlleellkdadivh
00517801   1/1  lleeleeegidtsgvlvlpdgetgvalilldkdgervtlivlpgaavllleldllvpalldllenadllv
00405001   1/1  ....................gtavitvltsgntgygvfagan..lspedlaeqldalledllkevdavlt
00498461   1/1  ..........................italtaqntilvlpgaa..lspeelaellealleladadavlig
00465771   1/1  ----------idsgggagigadllaalalgrygtglvtvlt.aqntllvlgasp..lmaddleellelle
00501931   1/1  ......................italtsqntgygvfpgavlspeelealleallellldldadavltGyl
00477051   1/1  ..........................italtaqntigv..gavlalppellaaqlealledlgadavktG
00446611   1/1  ----Gagiladlkalrlgaglvtvitnlvaqntiavyllalgalplmaevleeleellkdadalvigigl
00479081   1/1  ......................glvtvatpdntanvlasllpelmvlpledlleqleelleradalvigp
00518461   1/1  .....................aaplitalpelvvlgvlanaspimadlleellelleradalvigpGllr


                         +         -         -         -         -         *         -:210
query           AAIEAALTAAKAKRITTVINTAPLTADGPRLAGLADIVIANETEFELLIGKNGLSSGERESELKALHDRT
00527841   1/1  ylpleallallelakeagvpvvlDpngrplllleellpladllkpneeEaelltgllllsledleeaara
00432781   1/1  llpaeavlallelakeagvpvvlDpvmrdalleellpladiltpneeEaelltglkiedledleeaarkl
00463321   1/1  lspedld..lallagadvlhlsgyllgelpreallellelareagvlvvldpnprpllwlsrelllellp
00517601   1/1  lhlsgillalsepsreallealelakeagvlvsfdpnyrpalwsleearelllellpladilkpneeEae
00525531   1/1  paelpleallellelakeagvpvvlDpsgrallwllellaladllkpNeeElealtglelldledlllaa
00517411   1/1  lallpaeallallelakeagvpvvlDpngr.pllwellpladlltpneeEaaaltgleildeedleeaar
00460301   1/1  aalsledidllllllaaaalilllggllllselpreallkalelakeagvlvvldpnprpilwrakelll
00502481   1/1  ilp...ilallelareagvpvvlDpnlrpalleellpladlltpneeEaelltglkildeedleeaaral
00445871   1/1  gillallelsreallellelareagvkvsldpnlrlalwsveaarelllellaladllkpneeEaelllg
00524201   1/1  sgyllalselsaeavlkalelakaavlDpnlraklwlveeareallellplrgadlltpneeEaealtgl
00497421   1/1  sllselsleavlellelaraagvpvvlDpvmraklwlyaeealealrellpladlltpneeEaelltgle
00502181   1/1  lggllpleailellklakeagvlvvlDpngrlrlwsdlllveaarelllellplvdilkpneeEaelltg
00517801   1/1  vsglalggvsleailellelakelgipvvlDpsglllvlleellkladvlklsleeklealtglelesle
00405001   1/1  GylgsaeiveavaellkklkaknpgvpvvlDPvmadklllsggllvdeeavealreellpladiitPNlf
00498461   1/1  llgsaeaieavaellkaakgvpvvlDPvmadasglrllaeealaalleellpladvitPNltEaelltgl
00465771   1/1  dadvlvigpGlllsesleailaalelakeagipvvlDpvglgalllreelleallelllpdiitPNegEa
00501931   1/1  gseepieavaealklakaagpdvpvvlDPVmgdngglylladealealreellpladlitPNltEaellt
00477051   1/1  llgsaeiieavaellkklpgvpvvlDPvmadasglllladealealleellpladlitPNltEaalLlgl
00446611   1/1  lgslaaeavlaaaelareagkpvvlDpvglgalgfrleallelllpladvltPNlgEaaaLlglevalkg
00479081   1/1  glgrdeavlalleaaleagkpvvlDadalnllaerllplatvltPnlgEaarLlglsvddvledrleaar
00518461   1/1  seeaielvaellkeagvpvvlDadalnalalllelllpkatvltPNlgElarLlglsiddvedrleaare


                         -         -         -         +         -         -         -:280
query           GQTLIVTLGADGVIAMRNGKVFSASGLKIEPVDTVGAGDTFCGYLAASLDQGMDFEKALKRAAVAGSLAC
00527841   1/1  llelgvklvvvtlGaeGallltggggevlhvpapkvevvdttGAGDafaagflagllllaglsleealrl
00432781   1/1  lelgvkvvvvtlGakgallytggevlhvpapkvkvvdttGAGDafaagllaglaqglsleealrlAnaaa
00463321   1/1  lvdilkpneeEaaaltglt..dleeaaealllllelllllllllelleklarkllelgvklvvvtlGadG
00517601   1/1  lllgle.....dpeeaaaaalellllllellleallelgvklvvvTlGakgaallnllsgllltggevvh
00525531   1/1  aaklllalgvklvvvtlGadGallvtggevlhvpapkvevvdttGAGDafaAgllygllkgldleealrl
00517411   1/1  allalgvklvvvtlGaeGallatgggvlhvpappvevvdttGAGDafaagflaglaqglsleealrlAna
00460301   1/1  ellplvdilfpNeeEaealtgledleeedaeklllllaaaalllalgvklvvvtlGakGallvtgggvlh
00502481   1/1  lelgvklvvvtlGakGallvtgggvlhvpappvkvvdttGAGDafaagflaglaqglsleealrlAnaaa
00445871   1/1  ltdle..........llalgvklvvvtlGakGallvtggevlhvpafpvkvvDttGAGDafaAgflagll
00524201   1/1  .....ddleeaakkllelg.klvvvtlGekGallytggevlhvpapkvkvvdttGAGDafaagflagllk
00497421   1/1  .....dleeaarallelgvklvvvtlGadgallvtgggvlhvpapkvevvdttGAGDafaagllagllll
00502181   1/1  l.....edleeaakkllelgaklvvvtlGe.Gallf.dgevyeipafkvevvDttGAGDafaAgflagll
00517801   1/1  dpeeaaaelaklgv.vvvvTlGskgalvvdggkvilvlpapkvevvdttGAGDaFlagllyglvlqglsl
00405001   1/1  EaelLtgikindeedlkeaarkllelgakaVlitgghlgallvddlllldgslllvlllleggevflvpa
00498461   1/1  pitsledlleaarallalgakaVvvtggalggdllvalladgggvvrvpaprvevvdttGaGDtfaaala
00465771   1/1  erltglkllllkgvdsildledlleaakalaklggkvvvlt.Gakg.llvdggevlvvpagkvevvdttG
00501931   1/1  glkitsledlveaaraLlelgvkaVlvtgghllsldgdligallvtgdgvlllpaprvevlvvdtvGaGD
00477051   1/1  pvieteedllaaarallelgakaVlvtgghlegdlvgdllvdgdgvlllpaprvevvdttGaGDtlsaal
00446611   1/1  vdsleesledlleaaralaelgaavvvvt.Gahdvia.dggevlvvpagkvllvdttGaGDtlaaaiaaf
00479081   1/1  alaalggavvllk.Gahd.liatdggrvyvnatgnpalatgGaGDvLaGaiaallaqgldlleaaalAvy
00518461   1/1  laekggavvvlk.Gahdliadgdg..vlvnatgnpalatgGtGDvlagiiaallaqgldlleaaalAval


                         -         *         -         -         -         -         +:350
query           TRAGAQPSIPQAAEVDAAL---------------------------------------------------
00527841   1/1  AnaaAalvvtrlGaipslpt--------------------------------------------------
00432781   1/1  alavtrlGaipslptleel---------------------------------------------------
00463321   1/1  allvtgggvvllle--------------------------------------------------------
00517601   1/1  vpafkvkvvDttGAGDaFaa--------------------------------------------------
00525531   1/1  AnaaaalavtklGaqpslp---------------------------------------------------
00517411   1/1  aaalavtrlg....lptle---------------------------------------------------
00460301   1/1  vpvvpappvkvvDt--------------------------------------------------------
00502481   1/1  alavtrlGaipglptleel---------------------------------------------------
00445871   1/1  aglsleealrfAnaaAalvv--------------------------------------------------
00524201   1/1  glsleealrlAnaaAalvv---------------------------------------------------
00497421   1/1  kglslelleealrlAnaaaa--------------------------------------------------
00502181   1/1  lkgldleealrfAsaa------------------------------------------------------
00517801   1/1  vealrfAaaaAalavtqlga.-------------------------------------------------
00405001   1/1  prvevvdttGaGDtfaaala--------------------------------------------------
00498461   1/1  aalaqglsleeavrl-------------------------------------------------------
00465771   1/1  aGDtla----------------------------------------------------------------
00501931   1/1  tfaaalaaalakglsleeavr-------------------------------------------------
00477051   1/1  aaalaqglsleeavrlAva---------------------------------------------------
00446611   1/1  laqg.dllea------------------------------------------------------------
00479081   1/1  lhgaaadlav------------------------------------------------------------
00518461   1/1  hglaaelaaelgpgllasd---------------------------------------------------