[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for atum0:AAK86197.1


[Show Plain Result]

## Summary of Sequence Search
   1::294
   9::294  6.6e-87 46.9% 0052050 00520501 1/1   mate kinase-like                        
   5::294    2e-79 45.7% 0052046 00520461 1/1   mate kinase-like                        
   1::295  2.3e-76 42.2% 0051807 00518071 1/1   mate kinase-like                        
  25::292  3.4e-74 48.1% 0045891 00458911 1/1   mate kinase-like                        
  25::294  1.9e-73 47.4% 0036708 00367081 1/1   mate kinase-like                        
  24::294  2.8e-68 41.0% 0038241 00382411 1/1   mate kinase-like                        
  27::295  8.5e-49 37.8% 0053023 00530231 1/1   mate kinase-like                        
  26::295  5.2e-48 38.9% 0051788 00517881 1/1   mate kinase-like                        
  26::294  2.5e-47 40.4% 0052030 00520301 1/1   mate kinase-like                        
  26::294  2.5e-47 39.7% 0053148 00531481 1/1   mate kinase-like                        
  25::294  1.4e-44 37.8% 0052151 00521511 1/1   mate kinase-like                        
  21::294  1.5e-33 35.3% 0052013 00520131 1/1   mate kinase-like                        
  22::294  4.4e-33 35.0% 0051265 00512651 1/1   mate kinase-like                        
  21::293  1.9e-31 34.1% 0051682 00516821 1/1   mate kinase-like                        
  22::295  9.3e-31 33.5% 0051530 00515301 1/1   mate kinase-like                        
  89::292    4e-19 27.1% 0053112 00531121 1/1   mate kinase-like                        
   1::294


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTSSESEIQARLLAQALPFMQKYENKTIVVKYGGHAMGDSTLGKAFAEDIALLKQSGINPIVVHGGGPQI
00520501   1/1  --------lelllsllelvevlrealpyinafrgktiViklGGsaltdeelleslaediallkelgievv
00520461   1/1  ----dllelvevlrealpyinafrgkriViklGGsaltdlellkalaediallkelgievvvVhGggpqv
00518071   1/1  llllsllelvkvlrealpyinkfrgkriViklGGsaltdlellkslaediallrelgievvvVhGggpqv
00458911   1/1  ------------------------gkriViklGGnaltdegggldlqlellealaediallravGievvl
00367081   1/1  ------------------------mkriVvklGGsaladeggllsagldlerlealaediaelvklGvev
00382411   1/1  -----------------------rmkriViklGGsaltdlellealakdiaellrslgievvvVhGggpq
00530231   1/1  --------------------------riVvKfGGssladaerikkvaeiiallldlgvevvvVvsggggv
00517881   1/1  -------------------------kriViKlGGsaltdkggldlerlkalaeiiaelve.gvevvvVvG
00520301   1/1  -------------------------kriViKlGGsaladdgldlellkalaeiiaelle.gvevvvVvGG
00531481   1/1  -------------------------kriVvKfGGssladaerikkvaeiiael...gvevvvVvsagggv
00521511   1/1  ------------------------mskliVlkfGGtsladaenvrkvadiilellegnrvvvvsalgkvt
00520131   1/1  --------------------lllkykriVlKlGGsslagddglgldlerlkklaeiiaelvelgvevvvV
00512651   1/1  ---------------------llkmkriVlKlGGsslagedglgldlerlkrlaeiiaelvdlgvevvvV
00516821   1/1  --------------------lllkykriVlKlGGsslagedgllldlerlkrlaeiiaelvelgvevvvV
00515301   1/1  ---------------------llkykriVlKlGGsslagddgggldlerlkrlaeiiaelvdlgvevvvV
00531121   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           GAMLSKMGIESKFEGGLRVTDAKTVEIVEMVLAGSINKEIVALINQTGEWAIGLCGKDGNMVFAEKAKKT
00520501   1/1  lVhGggpqigllllklgiepkfvnglrvtdaatldvlaavgqgllnkllvaalnnagltavgllgtdgdl
00520461   1/1  gdlllklgiepkfvnglrvtdlatldalaavgqgllnallvaalnnlgltavqllgtdgglltakrlgna
00518071   1/1  gdlllalgiepefvdglrvtdlatldvlaavgqgllnlllvaalenlgvtavgllgtdgdlvtakpigna
00458911   1/1  VhGGgpqvgllllklgiasefvdparglrvtdaealaavgqvllgalnkelvalgldldvgllvaqvlvt
00367081   1/1  vvVhGggpqvgnlllklgleasflgldrrpldllgaqalaaiglrltdaltlelvemvlaglvnkllval
00382411   1/1  vgllllklgllpefvnglrvtdaatldvlaavgqgllnallvdalnnlgikavgllgtdgdlltarr...
00530231   1/1  tdlllglakaallgvdalsllelleailgrhleileellldlllleellkllvellgllseflnglrvlg
00517881   1/1  Ggvavgllllgl..........rvtdldeldalaavgqgllnallvaaleelgikaaqllltd.......
00520301   1/1  gpavgllllkl........alrgldlatldalaavgegllalllaaaleklgvpavqlll..........
00531481   1/1  tdlllalaelalkgdllelldallarhlgiiselllglrvtdlllllllelvllgivlldeldlalldal
00521511   1/1  rillklggsaltde.lalglaldvllalaqgiig.lvhggglvilvvsgalgigrglllglrvvdeltld
00520131   1/1  vgGgngvtdlll..........glrgldpatldylgalaevlnalllaaaleklgvaavlltaidllivt
00512651   1/1  vgGgngvgglll..........glrgldpatldllgalaevlsalllaaaleelgvaavlltaidlllvt
00516821   1/1  vgGgaiatglll..........lllgldprtldllgalaevlnalllaaaleklgvaavlltaidl....
00515301   1/1  vgGgvavgglllg..........llgldpatldllgalaevlnalllaaaleelgvaavlltaidlgivt
00531121   1/1  ------------------lsgevlvgvsvvlvssgalallakelkllldpreldalvagGevgsrgllaa


                         +         -         -         -         -         *         -:210
query           VIDPDSNIERVLDLGFVGEVVEVDRTLLDLLAKSEMIPVIAPVAPGRDGATYNINADTFAGAIAGALHAT
00520501   1/1  itakpigpfyteeeagvvlgidlglvgrvvlvdtelletlldagvipvvagiggvptgellnidaDtlAa
00520461   1/1  v...........dlgvvgeikpvdtetiealldagvipvvagfgggpvgelgngdsDtlAallAaalgAd
00518071   1/1  ysedg......vdlgvvgeilpvdrelilrlleagvipvvagfggvptgelgngdsDtlAallAaalgAd
00458911   1/1  addllfklgtkaiglsgkdgelilaeklgvvvvedagrgyrrvvpsprpvdlgavgtiktlldlgvipil
00367081   1/1  lvdlglpavglpgkdiglitaielaqalltaddlviredadlgyvgvvaspyprrivdtetikrllelgv
00382411   1/1  ..........llnarglvgvvesvdpetieallelgviPvvagnggvpvgelgngdsDtlAallAaalgA
00530231   1/1  pltlavldallalGellsalllaaaleelgvkavqldltdadlvtds.................rygnar
00517881   1/1  .................ddlsvgrielvaretlltllelgvipivagfdgvpvgelgfgdsDtlAallAa
00520301   1/1  .............................etllrllelgvipvvagfdg.......rgdsDtlAallAaa
00531481   1/1  aalGellsalllaallnelgvkavvldaaqvlltd...............edfldarivlnatevnletl
00521511   1/1  vldmlaavGellsalllaalleelgvkavqldgrdaglvta...........sdlpd..alglvgaieev
00520131   1/1  ep...........................lnarraipllnegdvvvvagftg.....lgrggsDtlAall
00512651   1/1  e...........................ylnartllrllelgvvpvvagfdg.....lgrgdsDtlAall
00516821   1/1  .....................givteplnarralr..llelgvvpivagfdg.....lprgdsDtlAall
00515301   1/1  e...........................ylnaetllrllelgvvpivngfd.....glgrggsDtlAall
00531121   1/1  yllglgraaldlagilltvlnalilqralnaigtllrllslivvpgfngndivgatttlgrgdsDtlAal


                         -         -         -         +         -         -         -:280
query           RLLFLTDVPGVLDKNKELIKELTVSEARALIKDGTISGGMIPKVETCIDAIKAGVQGVVILNGKTPHSVL
00520501   1/1  llAaalkAdkLiiltdvdgvydadpkliselsleellelaadgvitggmlpkleaallaleagvprvhii
00520461   1/1  kliiltdvdGvyt.dprlideitydealelaaggvitggmvpklraallaleagvkpvviisgrvpeall
00518071   1/1  kliiltdvdGvytadPpdaklideisydealela..gfitggmkvkleaaleaarrggipvviingrvpg
00458911   1/1  nenggipvitelgf...gvlanidnDtlAallAaalgAdlLiilTdvdgvydadpkpdaklisevtveel
00367081   1/1  ipiiaggggvpvveeedgltgelanidnDtaAallAaalgAdlliilTdvdgvytadprpdaklldelty
00382411   1/1  d.liiltdvdgvydadpkllpdatlleaislieaelatggmkvkllaaveaarkggipvviisgrvpgal
00530231   1/1  vieevirellerllekgvvpvvaGfiginenglvttlgrggsDtlAallAaalgAdlliilTdvdGvyta
00517881   1/1  algAdlliilTdvdGvytadPrkvpdaklideisyeealelalaggsgsglgtGgmvlklraallaaeag
00520301   1/1  lgAdlliilTdvdgvytadPrkvpdaklideisydellelaaggsilgtggmvlklraallaleagip.v
00531481   1/1  lalleagvvpvvaGfigvnenglvttlgrggsDttAallAaalgAdlliilTdvdGvytadPrivpdakl
00521511   1/1  irellktlleagvvpvvagfigvdveegelttlgrggsDtlAallAaalgAdlliilTdvdGvytadPrk
00520131   1/1  AaalgAdlllilTdvdGvytadPrkvpdaklidelsydealel.......ggmvlklraallaleagip.
00512651   1/1  AallgAdlllilTdvdGvytadPrkvpdaklideisydellel.......ggmvlklraallaleagip.
00516821   1/1  AallgAdlllilTdvdGvytadPrkvpdaklideisydealel.......ggmvlklraallaleagip.
00515301   1/1  AallgAdllliltndvdGvytadPrkvpdaklideisydealel.......ggmvlklraallaaeagip
00531121   1/1  lAaalgAdlliilTdVdGvYtadPrkvpdaklideisyeealelasagsllgtggmvlklraaelaaeng


                         -         *         -         -         -         -         +:350
query           LEIFTEGAGTLIVP--------------------------------------------------------
00520501   1/1  sgrvpealllelft--------------------------------------------------------
00520461   1/1  lelfgdegvGTliv--------------------------------------------------------
00518071   1/1  alllelltgegvGTl-------------------------------------------------------
00458911   1/1  eeligdgsfitg----------------------------------------------------------
00367081   1/1  eellelasgggfit--------------------------------------------------------
00382411   1/1  l.elltgegiGTli--------------------------------------------------------
00530231   1/1  dPrivpdaklidels-------------------------------------------------------
00517881   1/1  ip.vvilngfepgnl-------------------------------------------------------
00520301   1/1  vilngrnpgnllei--------------------------------------------------------
00531481   1/1  idelsydealelay--------------------------------------------------------
00521511   1/1  vpdaklldelsyde--------------------------------------------------------
00520131   1/1  vvilngfkpgnllr--------------------------------------------------------
00512651   1/1  vvilngfnpgnlle--------------------------------------------------------
00516821   1/1  vvilngfnpgnll---------------------------------------------------------
00515301   1/1  .vvilngfnpgnllr-------------------------------------------------------
00531121   1/1  ip.vvvfngfnp----------------------------------------------------------