[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for atum0:AAK86297.2


[Show Plain Result]

## Summary of Sequence Search
   1::216
   1::135  4.7e-25 28.9% 0039925 00399251 1/1   like                                    
   2::133    8e-23 30.3% 0047753 00477531 1/1   like                                    
   1::123  1.1e-22 30.8% 0043525 00435251 1/1   like                                    
   1::140  2.7e-22 29.7% 0045700 00457001 1/1   like                                    
   1::130  4.3e-22 32.3% 0047296 00472961 1/1   like                                    
   2::140  9.9e-22 29.7% 0045682 00456821 1/1   like                                    
   1::124    3e-21 32.8% 0047555 00475551 1/1   like                                    
   3::125  5.6e-21 30.3% 0046428 00464281 1/1   like                                    
   3::122  5.9e-21 31.9% 0048656 00486561 1/1   like                                    
   1::124  1.8e-20 33.1% 0046294 00462941 1/1   like                                    
   2::132  1.8e-20 30.5% 0051318 00513181 1/1   like                                    
   3::123  2.4e-20 31.6% 0051573 00515731 1/1   like                                    
   1::124  2.5e-20 33.1% 0047867 00478671 1/1   like                                    
   1::123  2.8e-20 32.2% 0048705 00487051 1/1   like                                    
   4::146  2.9e-20 30.0% 0048975 00489751 1/1   like                                    
   4::143    4e-20 28.5% 0048465 00484651 1/1   like                                    
   1::123  5.9e-20 34.7% 0050342 00503421 1/1   like                                    
   3::142  7.2e-20 29.2% 0050341 00503411 1/1   like                                    
   3::122  8.7e-20 33.1% 0049761 00497611 1/1   like                                    
   2::123  1.4e-19 29.7% 0046299 00462991 1/1   like                                    
   4::124  1.9e-19 33.3% 0051574 00515741 1/1   like                                    
   1::131  2.2e-19 30.5% 0051860 00518601 1/1   like                                    
   2::125  3.1e-19 31.4% 0048231 00482311 1/1   like                                    
   3::124  4.8e-19 31.9% 0049456 00494561 1/1   like                                    
   2::123    8e-19 33.6% 0048685 00486851 1/1   like                                    
   3::125  8.4e-19 31.7% 0045852 00458521 1/1   like                                    
   3::123  8.6e-19 30.5% 0047799 00477991 1/1   like                                    
   2::124    9e-19 31.1% 0050964 00509641 1/1   like                                    
   3::123  2.5e-18 31.4% 0051386 00513861 1/1   like                                    
   3::124  3.2e-17 30.3% 0048129 00481291 1/1   like                                    
   4::123  3.5e-17 32.8% 0048463 00484631 1/1   like                                    
   2::124  3.7e-17 30.8% 0051898 00518981 1/1   like                                    
   1::124  8.3e-17 30.2% 0048997 00489971 1/1   like                                    
   1::124  1.4e-16 31.4% 0048066 00480661 1/1   like                                    
 130::211  1.7e-16 37.8% 0048694 00486941 1/1   minal effector domain of the bipartite  
 140::209    5e-15 45.7% 0051317 00513171 1/1   minal effector domain of the bipartite  
 148::214  1.2e-13 44.8% 0046851 00468511 1/1   minal effector domain of the bipartite  
 146::211  1.4e-13 45.5% 0045681 00456811 1/1   minal effector domain of the bipartite  
 148::212  4.8e-13 46.2% 0047924 00479241 1/1   minal effector domain of the bipartite  
 134::215  3.3e-08 24.4% 0049695 00496951 1/1   3 and sigma4 domains of RNA polymerase  
 118::203  1.4e-05 24.4% 0039239 00392391 1/1   3 and sigma4 domains of RNA polymerase  
 134::194  0.00011 29.5% 0041987 00419871 1/1   3 and sigma4 domains of RNA polymerase  
   1::216


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSELVIIIADDHPLFRGALKQAVAGLDGQQTIIEAGDFEAARHAATTRNDADLMLLDLAMPGVSGFSGLM
00399251   1/1  plslsglrvLvVdDdplirellrrlLeklgylevvltaadgeealellrelgalaglelglrpdlvllDi
00477531   1/1  -kglriLiVdDdplirellrrlLeklgllyvvltaadgeealellrellalgslerpdlvllDlnmPgmd
00435251   1/1  msglrvLvVDDdplirellrrlLer.lgyevvgtaadgeeAlelleelp.pdlvllDirmPgmdGlellr
00457001   1/1  lsklriliVdDdplirellrrlLeslgdlyvvltaadgeealellrelr.pdlvllDlmmPgmdGlellr
00472961   1/1  lsglriLiVdDdplirellrrlLeklgllyevleaadgeealellrellelgdllrpdlvllDlnmPgmd
00456821   1/1  -kklriliVdDdplirellrrlLeslgdlyvvleaadgeealellrelr.pdlvllDlmmPgmdGlellr
00475551   1/1  llsglriLvVdDdpllrellrllLekl.gyevvleaadgeealellrelr.pdlvllDlmmPgmdGlell
00464281   1/1  --klrilivdDdpllrellrllLeslgllyvvltaadgeealelleelr.pdlvllDimmPgmdGlellr
00486561   1/1  --glrilvvdDdpllrellkllLekl.gyevvlvaadgeealellrellesglrpdlvllDilmPgmdGl
00462941   1/1  lsklriliVdDdplvrellallLeslgy..vvltaadgeealellrelr.pdlvllDlrmPgmdGlellr
00513181   1/1  -sglrilvVdDdplirellrllLeslgye..vltaadgeealellrelr.pdlvllDirmPgmdGlellr
00515731   1/1  --glriliVdDdpllrellallLeklgy..vvltaadgeealellrelr.pdlvllDimmPgmdGlellr
00478671   1/1  lsglrilvvdDdpllrellallLeslgy..vvltaadgeealellrelr.pdlvllDlrmPgmdGlellr
00487051   1/1  llllsglriLvVdDdplirellallLesl.gyevvltaadgeealellrelp.pdlvllDlmmPgmdGle
00489751   1/1  ---lriliVdDdplirellrllLerl.gye.vltaadgeealellrelr.pdlvllDirmPgmdGlellr
00484651   1/1  ---lriLiVdDdplirellrllLekl.gye.vltaadgeealelleelr.pdlvllDlmmPgmdGlellr
00503421   1/1  llllllsllllsglriLvVdDdplirellarlLekl.gyev...aadgeealellrelp.pdlvllDlmm
00503411   1/1  --glriLvVdDdpllrellrllLeklgy..evltaadgeealellrelr.pdlvllDimmPgmdGlellr
00497611   1/1  --glrilivdDdpllrellallLek.lgyevvgeaadgeealellrelr.pdlvllDllmPgmdGlellr
00462991   1/1  -lllelsglrvLvVdDnplnrellkalLeklgy..evltasngeealell..elppdlvllDiqmPgmdG
00515741   1/1  ---lriLvvdDdpllrellrllLeslgy..vvleaadgeealellrelr.pdlvllDlmmPgmdGlellr
00518601   1/1  ealsslsglrilvVdDdplvrellrrlLerl.gyevv.taadgeealellrelp.pdlvllDlrmpgmdG
00482311   1/1  -sglrilvvdDdpllrellallLeklgy..vvltaadgeealellrelr.pdlvllDimmPgmdGlellr
00494561   1/1  --klrilivdDdpllrellallLeslgy..vvltaadgeealellrelr.pdlvllDllmPgmdGlellr
00486851   1/1  -sglrilivdDdpllrellallLeslgy..vvltaadgeealelle....pdlvllDilmPgmdGlellr
00458521   1/1  --glriLvVdDdpllrellallLeslgy..vvltaadgeealellrelr.pdlvllDlmmPgmdGlellr
00477991   1/1  --glrilvvdDdpllrellallLeklgy..vvltaadgeealellrelp.pdlvllDimmPgmdGlellr
00509641   1/1  -sglrilvVdDdpllrellrllLeslgye..vltaadgeealelleelr.pdlvllDimmPgmdGlellr
00513861   1/1  --glrilvvdDdpllrellallLeslgy..vvltaadgeealellrelr.pdlvllDlmmPgmdGlellr
00481291   1/1  --glriLvvdDdpllrellallLeklgy..vvltaadgeealellrelr.pdlvllDimmPgmdGlellr
00484631   1/1  ---lrilivdDdpllrellallLeklgy..vvltaadgeealellrelr.pdlvllDimmPgmdGlellr
00518981   1/1  -sglrilvvdDdpllrellallLesl..gyevvtaadgeealellrelerpdllvllD.llPgmdGlell
00489971   1/1  ltllllknlrglrilvvdddplvrellrrlLerl.gyevva.aadgeeale.....lrpdlvlldlrmpd
00480661   1/1  lrsklrilivdddpalrellrrlLeaegyq..vlvaesgeealelleeh.rpdlvlldlmlPgmdglell
00486941   1/1  ----------------------------------------------------------------------
00513171   1/1  ----------------------------------------------------------------------
00468511   1/1  ----------------------------------------------------------------------
00456811   1/1  ----------------------------------------------------------------------
00479241   1/1  ----------------------------------------------------------------------
00496951   1/1  ----------------------------------------------------------------------
00392391   1/1  ----------------------------------------------------------------------
00419871   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           ALRAEFSSLPIVIVSATDDATTVRRSIELGASGFISKSSGIDDIRDGIRAVLEGDVWIPSGHQGEKEQDP
00399251   1/1  nmPgmdGlellrrlralpllpdipvivlTaladeedrvraleaGaddyllKPfdleeLlaairal-----
00477531   1/1  GlellrrlrelpllpdipvivlTalddeedavraleagaddyllKPfdleeLlaairallrrl-------
00435251   1/1  rlre.lpdipvillTayadeedavraleaGaddyltKPfdleeLlaalrrale-----------------
00457001   1/1  rlre.lpdipvivlTalddelledavraleagaddyllKPfdleeLlaairallrrlrllsellalllll
00472961   1/1  GlellrrlrelpalpdipvivlTalddeedavraleagaddyltKPfdleeLlaairall----------
00456821   1/1  rlrellpdipvivlTayddeedavraleagaddyllKpfdleeLlaairallrrlrllsellaelllell
00475551   1/1  rrlrelpllpdipvillTaladeedavraleagaddyllKPfdleeLlaalral----------------
00464281   1/1  rlrelplpdipvivlTaladeedavraleagaddyllKPfdleeLlaalrallrr---------------
00486561   1/1  ellrrlrelllpdipvillTaladeedavraleagaddyllKPfdleeLlaa------------------
00462941   1/1  rlrellpdipvillTayddeedavealeagaddyllKPfdleeLlaairallrr----------------
00513181   1/1  rlrellpdipvillTayddeedavraleagaddyllKPfdleeLlaairallrrlrllsenl--------
00515731   1/1  rlre.lpdipvillTaladeedavraleagaddyllKPfdleeLlaalrallr-----------------
00478671   1/1  rlrellpdlpvillTaladeedavraleagaddyllKPfdleeLlaairallrr----------------
00487051   1/1  llrrlrelpllpdipvillTaladeedavraleagaddyllKPfdleeLlaal-----------------
00489751   1/1  rlrelgpdlpvillTayddeedavraleagaddyllKPfdleeLlaairallrrlrllrellllllllel
00484651   1/1  rlrelgpdipvillTayadeedavealeagaddyllKPfdleeLlaairallrrlrllrelllllellel
00503421   1/1  PgmdGlellrrlrelpalpdipvillTalddeedrvraleaGaddyltKPfdp-----------------
00503411   1/1  rlrelpllpdipvillTalddeedavraleagaddyltKPfdleeLlarirallrrlrllsellllleel
00497611   1/1  rlrellpdlpvivlTaladeedavealeagaddyllKPfdleeLlaalralL------------------
00462991   1/1  lellrrirelellpllpdipiialtayadeedreraleagaddyltKPvslee-----------------
00515741   1/1  rlre.lpdipvivlTalddeedavraleagaddyllKPfdleeLlaalrallrr----------------
00518601   1/1  lellrrlrellpdipvillTayadeedavraleagaddyllKPfdleeLlaalrallrrlr---------
00482311   1/1  rlrelgpdipvillTalddeedavraleagaddyllKPfdleeLlaalrallrrr---------------
00494561   1/1  rlrellpdipvillTayadledavraleagaddyllKPfdleeLlaalrallrr----------------
00486851   1/1  rlrellpdipvillTalddeedavealeagaddyllKPfdleeLlaairallr-----------------
00458521   1/1  rlrellllpdipvillTaladeedavraleagaddyllKPfdleeLlaairallr---------------
00477991   1/1  rlrelgpdipvillTaladeedavraleagaddyllKPfdleeLlaalrallr-----------------
00509641   1/1  rlre.lpdipvillTaladeedavraleagaddyllKPfdleeLlaalrallrr----------------
00513861   1/1  rlrelgpdipvivlTaladeedavraleagaddyllKPfdleeLlaalrallr-----------------
00481291   1/1  rlrelpalpdipvillTaladeedavraleagaddyllKPfdleeLlaalrall----------------
00484631   1/1  rlre.lpdipvillTalddeedavraleagaddyllKPfdleeLlaalrallr-----------------
00518981   1/1  rrlrellpdlpvillTaldde..avraleag.ddyllKPfdleeLlaalrrrll----------------
00489971   1/1  mdglellallre.lpdlpvivltayedpelleaaleagaldylvkPldpeeLla----------------
00480661   1/1  rqLreeglllPvilltardd...rvaaldagaddyltkPfllpvdqleeLlari----------------
00486941   1/1  -----------------------------------------------------------lllelllllll
00513171   1/1  ---------------------------------------------------------------------l
00468511   1/1  ----------------------------------------------------------------------
00456811   1/1  ----------------------------------------------------------------------
00479241   1/1  ----------------------------------------------------------------------
00496951   1/1  ---------------------------------------------------------------elleeel
00392391   1/1  -----------------------------------------------lpvgddddlelldllpdddapsp
00419871   1/1  ---------------------------------------------------------------eallale


                         +         -         -         -         -         *         -:210
query           DVADLIGRLRTLTPQQSRVLGMLAEGLLNKQIAYELNVSEATIKAHVSAILLKLKVDSRTQAVIQLAKIN
00399251   1/1  ----------------------------------------------------------------------
00477531   1/1  ----------------------------------------------------------------------
00435251   1/1  ----------------------------------------------------------------------
00457001   1/1  ----------------------------------------------------------------------
00472961   1/1  ----------------------------------------------------------------------
00456821   1/1  ----------------------------------------------------------------------
00475551   1/1  ----------------------------------------------------------------------
00464281   1/1  ----------------------------------------------------------------------
00486561   1/1  ----------------------------------------------------------------------
00462941   1/1  ----------------------------------------------------------------------
00513181   1/1  ----------------------------------------------------------------------
00515731   1/1  ----------------------------------------------------------------------
00478671   1/1  ----------------------------------------------------------------------
00487051   1/1  ----------------------------------------------------------------------
00489751   1/1  lldlla----------------------------------------------------------------
00484651   1/1  llg-------------------------------------------------------------------
00503421   1/1  ----------------------------------------------------------------------
00503411   1/1  el--------------------------------------------------------------------
00497611   1/1  ----------------------------------------------------------------------
00462991   1/1  ----------------------------------------------------------------------
00515741   1/1  ----------------------------------------------------------------------
00518601   1/1  ----------------------------------------------------------------------
00482311   1/1  ----------------------------------------------------------------------
00494561   1/1  ----------------------------------------------------------------------
00486851   1/1  ----------------------------------------------------------------------
00458521   1/1  ----------------------------------------------------------------------
00477991   1/1  ----------------------------------------------------------------------
00509641   1/1  ----------------------------------------------------------------------
00513861   1/1  ----------------------------------------------------------------------
00481291   1/1  ----------------------------------------------------------------------
00484631   1/1  ----------------------------------------------------------------------
00518981   1/1  ----------------------------------------------------------------------
00489971   1/1  ----------------------------------------------------------------------
00480661   1/1  ----------------------------------------------------------------------
00486941   1/1  llalllaalalLtprErevlrllaeGlsnkeIAerlgisekTVkthlsrilrKlgvrnraelvalalrlg
00513171   1/1  llldllallllLtprElevlrllaeglsnkeIAellgisekTVkthlsrilrKlgvrsraelvalalel-
00468511   1/1  -------pllsLtprElevlrllaeglsnkeiAellgisekTVkthlsnilrKlgvssraelvalalrlg
00456811   1/1  -----ddllllLtprelevlrllaeglsnkeiAellgisekTVkthlsnilrKlgvrsraelvalalelg
00479241   1/1  -------dllsLtprelevlrllaeGlsnkeiAellgisekTVkthlsnilrklgvrsraelvalalrlg
00496951   1/1  lrelleealetLsererevlrlryGlldlegltleeiAevlgvsrerVrqiekralkkLrkalraellrl
00392391   1/1  eelleaeelrellleaLekLpererevlrlryGlldlegltleeiAeilgvsrerVrqiesrA-------
00419871   1/1  llllllralerLperqrevlllryleglsyeeiAeilgisvgtvksrlsrArkk----------------


                         -         -         -         +         -         -         -:280
query           TSAMVA----------------------------------------------------------------
00399251   1/1  ----------------------------------------------------------------------
00477531   1/1  ----------------------------------------------------------------------
00435251   1/1  ----------------------------------------------------------------------
00457001   1/1  ----------------------------------------------------------------------
00472961   1/1  ----------------------------------------------------------------------
00456821   1/1  ----------------------------------------------------------------------
00475551   1/1  ----------------------------------------------------------------------
00464281   1/1  ----------------------------------------------------------------------
00486561   1/1  ----------------------------------------------------------------------
00462941   1/1  ----------------------------------------------------------------------
00513181   1/1  ----------------------------------------------------------------------
00515731   1/1  ----------------------------------------------------------------------
00478671   1/1  ----------------------------------------------------------------------
00487051   1/1  ----------------------------------------------------------------------
00489751   1/1  ----------------------------------------------------------------------
00484651   1/1  ----------------------------------------------------------------------
00503421   1/1  ----------------------------------------------------------------------
00503411   1/1  ----------------------------------------------------------------------
00497611   1/1  ----------------------------------------------------------------------
00462991   1/1  ----------------------------------------------------------------------
00515741   1/1  ----------------------------------------------------------------------
00518601   1/1  ----------------------------------------------------------------------
00482311   1/1  ----------------------------------------------------------------------
00494561   1/1  ----------------------------------------------------------------------
00486851   1/1  ----------------------------------------------------------------------
00458521   1/1  ----------------------------------------------------------------------
00477991   1/1  ----------------------------------------------------------------------
00509641   1/1  ----------------------------------------------------------------------
00513861   1/1  ----------------------------------------------------------------------
00481291   1/1  ----------------------------------------------------------------------
00484631   1/1  ----------------------------------------------------------------------
00518981   1/1  ----------------------------------------------------------------------
00489971   1/1  ----------------------------------------------------------------------
00480661   1/1  ----------------------------------------------------------------------
00486941   1/1  l---------------------------------------------------------------------
00513171   1/1  ----------------------------------------------------------------------
00468511   1/1  lldl------------------------------------------------------------------
00456811   1/1  l---------------------------------------------------------------------
00479241   1/1  li--------------------------------------------------------------------
00496951   1/1  lllll-----------------------------------------------------------------
00392391   1/1  ----------------------------------------------------------------------
00419871   1/1  ----------------------------------------------------------------------