[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for atum0:AAK86457.1


[Show Plain Result]

## Summary of Sequence Search
   1::418
 109::384  5.8e-79 37.1% 0040196 00401961 1/1   nosyl-L-methionine-dependent methyltran 
 121::384    2e-77 43.1% 0052709 00527091 1/1   nosyl-L-methionine-dependent methyltran 
 113::384  5.3e-72 35.9% 0047851 00478511 1/1   nosyl-L-methionine-dependent methyltran 
 112::384  7.7e-65 34.7% 0049671 00496711 1/1   nosyl-L-methionine-dependent methyltran 
 124::384  1.1e-60 35.1% 0047919 00479191 1/1   nosyl-L-methionine-dependent methyltran 
 121::366  2.4e-58 35.1% 0047945 00479451 1/1   nosyl-L-methionine-dependent methyltran 
 140::385  6.8e-55 34.5% 0041444 00414441 1/1   nosyl-L-methionine-dependent methyltran 
  13::339  7.7e-54 35.2% 0049778 00497781 1/1   nosyl-L-methionine-dependent methyltran 
 125::385  2.9e-51 34.3% 0046696 00466961 1/1   nosyl-L-methionine-dependent methyltran 
 112::395  4.2e-48 29.0% 0051884 00518841 1/1   nosyl-L-methionine-dependent methyltran 
 120::344  3.4e-47 28.7% 0050762 00507621 1/1   nosyl-L-methionine-dependent methyltran 
 147::363  1.2e-46 30.3% 0049171 00491711 1/1   nosyl-L-methionine-dependent methyltran 
  94::365  9.3e-46 29.4% 0051261 00512611 1/1   nosyl-L-methionine-dependent methyltran 
 113::341    1e-45 28.5% 0052536 00525361 1/1   nosyl-L-methionine-dependent methyltran 
 138::385  6.5e-45 30.3% 0046931 00469311 1/1   nosyl-L-methionine-dependent methyltran 
 139::385  8.3e-45 29.7% 0052807 00528071 1/1   nosyl-L-methionine-dependent methyltran 
  96::347  2.2e-43 29.3% 0049074 00490741 1/1   nosyl-L-methionine-dependent methyltran 
 125::382  4.8e-42 28.0% 0047656 00476561 1/1   nosyl-L-methionine-dependent methyltran 
 109::344  1.7e-41 29.1% 0045060 00450601 1/1   nosyl-L-methionine-dependent methyltran 
 114::341  5.7e-41 31.8% 0051103 00511031 1/1   nosyl-L-methionine-dependent methyltran 
 116::376  6.7e-41 31.3% 0051885 00518851 1/1   nosyl-L-methionine-dependent methyltran 
 156::381  2.1e-40 30.1% 0050234 00502341 1/1   nosyl-L-methionine-dependent methyltran 
 108::341  2.4e-40 28.4% 0049122 00491221 1/1   nosyl-L-methionine-dependent methyltran 
 114::344  4.9e-40 29.7% 0048490 00484901 1/1   nosyl-L-methionine-dependent methyltran 
 116::308  3.6e-39 33.2% 0050988 00509881 1/1   nosyl-L-methionine-dependent methyltran 
 110::347  4.8e-39 29.6% 0049719 00497191 1/1   nosyl-L-methionine-dependent methyltran 
  84::330  6.3e-39 23.9% 0047329 00473291 1/1   nosyl-L-methionine-dependent methyltran 
  43::335    7e-39 25.6% 0049885 00498851 1/1   nosyl-L-methionine-dependent methyltran 
 116::373  2.2e-38 30.4% 0051842 00518421 1/1   nosyl-L-methionine-dependent methyltran 
 143::346  4.1e-38 33.0% 0053077 00530771 1/1   nosyl-L-methionine-dependent methyltran 
 113::337  4.6e-38 29.7% 0046354 00463541 1/1   nosyl-L-methionine-dependent methyltran 
  96::336    5e-38 25.1% 0046840 00468401 1/1   nosyl-L-methionine-dependent methyltran 
 122::344  6.1e-38 31.4% 0051239 00512391 1/1   nosyl-L-methionine-dependent methyltran 
  96::337    5e-37 26.7% 0046838 00468381 1/1   nosyl-L-methionine-dependent methyltran 
 159::393  5.2e-37 26.8% 0051143 00511431 1/1   nosyl-L-methionine-dependent methyltran 
 110::367  7.8e-37 25.1% 0049915 00499151 1/1   nosyl-L-methionine-dependent methyltran 
 116::371  2.7e-36 26.1% 0048629 00486291 1/1   nosyl-L-methionine-dependent methyltran 
 121::343  8.5e-36 29.6% 0051679 00516791 1/1   nosyl-L-methionine-dependent methyltran 
 115::323  8.9e-36 27.4% 0044689 00446891 1/1   nosyl-L-methionine-dependent methyltran 
 114::319  1.5e-35 26.6% 0049474 00494741 1/1   nosyl-L-methionine-dependent methyltran 
 137::337  2.7e-35 28.1% 0047386 00473861 1/1   nosyl-L-methionine-dependent methyltran 
 135::365  1.1e-34 29.8% 0050154 00501541 1/1   nosyl-L-methionine-dependent methyltran 
 116::306  1.2e-34 30.4% 0047471 00474711 1/1   nosyl-L-methionine-dependent methyltran 
 100::351  6.7e-34 23.7% 0049532 00495321 1/1   nosyl-L-methionine-dependent methyltran 
 121::342  8.1e-34 26.4% 0050935 00509351 1/1   nosyl-L-methionine-dependent methyltran 
 111::329  8.6e-34 28.6% 0041580 00415801 1/1   nosyl-L-methionine-dependent methyltran 
 119::358  3.6e-33 29.3% 0050242 00502421 1/1   nosyl-L-methionine-dependent methyltran 
  99::329  5.2e-33 26.5% 0042197 00421971 1/1   nosyl-L-methionine-dependent methyltran 
 117::307  8.7e-33 27.6% 0050745 00507451 1/1   nosyl-L-methionine-dependent methyltran 
  95::311    5e-32 24.5% 0051823 00518231 1/1   nosyl-L-methionine-dependent methyltran 
 135::373  9.6e-32 24.7% 0045109 00451091 1/1   nosyl-L-methionine-dependent methyltran 
 117::317  2.2e-31 25.5% 0043085 00430851 1/1   nosyl-L-methionine-dependent methyltran 
  75::281  3.2e-31 26.3% 0044550 00445501 1/1   nosyl-L-methionine-dependent methyltran 
  99::305  3.2e-31 25.3% 0047580 00475801 1/1   nosyl-L-methionine-dependent methyltran 
 115::340  6.5e-31 28.5% 0046744 00467441 1/1   nosyl-L-methionine-dependent methyltran 
 106::302  1.8e-30 28.4% 0041593 00415931 1/1   nosyl-L-methionine-dependent methyltran 
 122::336    4e-30 25.5% 0050919 00509191 1/1   nosyl-L-methionine-dependent methyltran 
  96::301  5.4e-30 28.3% 0051930 00519301 1/1   nosyl-L-methionine-dependent methyltran 
 140::313    6e-30 29.3% 0047923 00479231 1/1   nosyl-L-methionine-dependent methyltran 
 115::324  9.9e-30 27.4% 0048438 00484381 1/1   nosyl-L-methionine-dependent methyltran 
 127::344  1.1e-29 27.0% 0047211 00472111 1/1   nosyl-L-methionine-dependent methyltran 
 119::277  1.7e-29 30.1% 0047465 00474651 1/1   nosyl-L-methionine-dependent methyltran 
 122::305  3.6e-29 25.7% 0052618 00526181 1/1   nosyl-L-methionine-dependent methyltran 
 110::308  8.2e-29 27.5% 0052182 00521821 1/1   nosyl-L-methionine-dependent methyltran 
 109::322  5.9e-28 24.9% 0037982 00379821 1/1   nosyl-L-methionine-dependent methyltran 
 152::325  9.6e-28 32.9% 0052649 00526491 1/1   nosyl-L-methionine-dependent methyltran 
 146::328  2.6e-27 28.9% 0051449 00514491 1/1   nosyl-L-methionine-dependent methyltran 
 119::327  3.5e-27 27.6% 0051657 00516571 1/1   nosyl-L-methionine-dependent methyltran 
 124::341  1.2e-26 24.3% 0040964 00409641 1/1   nosyl-L-methionine-dependent methyltran 
 154::289  1.2e-26 33.3% 0051617 00516171 1/1   nosyl-L-methionine-dependent methyltran 
 115::336  1.5e-25 21.8% 0036610 00366101 1/1   nosyl-L-methionine-dependent methyltran 
 152::279  2.4e-25 32.2% 0047676 00476761 1/1   nosyl-L-methionine-dependent methyltran 
 128::280  2.8e-25 28.9% 0039093 00390931 1/1   nosyl-L-methionine-dependent methyltran 
 150::325  1.8e-24 26.9% 0040829 00408291 1/1   nosyl-L-methionine-dependent methyltran 
 121::337  1.2e-22 21.0% 0040327 00403271 1/1   nosyl-L-methionine-dependent methyltran 
 115::333  2.4e-22 29.7% 0041326 00413261 1/1   nosyl-L-methionine-dependent methyltran 
 161::306  4.8e-22 29.4% 0053107 00531071 1/1   nosyl-L-methionine-dependent methyltran 
 152::304  5.5e-22 26.6% 0046568 00465681 1/1   nosyl-L-methionine-dependent methyltran 
 151::344  6.2e-22 22.9% 0048805 00488051 1/1   nosyl-L-methionine-dependent methyltran 
 152::367  1.8e-21 23.5% 0042682 00426821 1/1   nosyl-L-methionine-dependent methyltran 
 140::284  1.1e-19 23.7% 0035026 00350261 1/1   nosyl-L-methionine-dependent methyltran 
 154::291  1.1e-19 30.7% 0052084 00520841 1/1   nosyl-L-methionine-dependent methyltran 
  96::277  1.3e-19 21.7% 0049442 00494421 1/1   nosyl-L-methionine-dependent methyltran 
 107::279  1.6e-19 27.2% 0051840 00518401 1/1   nosyl-L-methionine-dependent methyltran 
 152::276    2e-18 30.0% 0051944 00519441 1/1   nosyl-L-methionine-dependent methyltran 
 162::278  6.6e-18 28.4% 0050519 00505191 1/1   nosyl-L-methionine-dependent methyltran 
 127::302  1.2e-17 21.3% 0050749 00507491 1/1   nosyl-L-methionine-dependent methyltran 
 148::341  1.3e-17 25.5% 0047862 00478621 1/1   nosyl-L-methionine-dependent methyltran 
 170::353  1.4e-17 22.8% 0052894 00528941 1/1   nosyl-L-methionine-dependent methyltran 
 170::292  1.7e-17 31.1% 0048774 00487741 1/1   nosyl-L-methionine-dependent methyltran 
 133::280  1.8e-17 23.7% 0053229 00532291 1/1   nosyl-L-methionine-dependent methyltran 
 150::296    5e-17 29.2% 0053110 00531101 1/1   nosyl-L-methionine-dependent methyltran 
 154::285  1.7e-14 23.8% 0049069 00490691 1/1   nosyl-L-methionine-dependent methyltran 
 145::279  1.1e-13 21.4% 0052749 00527491 1/1   nosyl-L-methionine-dependent methyltran 
 162::284    1e-12 23.7% 0047303 00473031 1/1   nosyl-L-methionine-dependent methyltran 
 113::332  1.3e-12 19.6% 0052982 00529821 1/1   nosyl-L-methionine-dependent methyltran 
 117::281  2.5e-12 25.3% 0052001 00520011 1/1   nosyl-L-methionine-dependent methyltran 
 145::276  3.9e-11 26.1% 0053087 00530871 1/1   nosyl-L-methionine-dependent methyltran 
 132::276  2.5e-10 20.7% 0050693 00506931 1/1   nosyl-L-methionine-dependent methyltran 
 162::276  3.2e-10 25.0% 0048524 00485241 1/1   nosyl-L-methionine-dependent methyltran 
 154::335  1.5e-09 19.6% 0049186 00491861 1/1   nosyl-L-methionine-dependent methyltran 
 131::276  6.6e-09 23.0% 0052739 00527391 1/1   nosyl-L-methionine-dependent methyltran 
  63::245    2e-08 21.3% 0036976 00369761 1/1   nosyl-L-methionine-dependent methyltran 
 146::314  1.6e-07 20.8% 0040551 00405511 1/1   )-binding Rossmann-fold domains         
 155::294  6.6e-07 18.9% 0036746 00367461 1/1   )-binding Rossmann-fold domains         
 162::281  7.5e-07 24.1% 0052510 00525101 1/1   nosyl-L-methionine-dependent methyltran 
 172::309  8.1e-07 22.7% 0052693 00526931 1/1   nosyl-L-methionine-dependent methyltran 
 146::301  8.8e-07 17.8% 0043276 00432761 1/1   )-binding Rossmann-fold domains         
 165::217  3.3e-05 32.7% 0037952 00379521 1/1   nosyl-L-methionine-dependent methyltran 
 147::313  4.1e-05 21.7% 0042366 00423661 1/1   )-binding Rossmann-fold domains         
 148::314  0.00028 19.1% 0038379 00383791 1/1   )-binding Rossmann-fold domains         
 171::315  0.00061 22.6% 0051327 00513271 1/1   )-binding Rossmann-fold domains         
   1::418


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MASSLHVLLEKIIKIGDLTVNSPGGSRTFGDGTGKKVVLNFTDEAAMQEIAADPALKLAEMYMEGRAKVA
00401961   1/1  ----------------------------------------------------------------------
00527091   1/1  ----------------------------------------------------------------------
00478511   1/1  ----------------------------------------------------------------------
00496711   1/1  ----------------------------------------------------------------------
00479191   1/1  ----------------------------------------------------------------------
00479451   1/1  ----------------------------------------------------------------------
00414441   1/1  ----------------------------------------------------------------------
00497781   1/1  ------------vlakvlllkllsklflglltvrlwdgtvtfggglktsifltildvlpillalilvlds
00466961   1/1  ----------------------------------------------------------------------
00518841   1/1  ----------------------------------------------------------------------
00507621   1/1  ----------------------------------------------------------------------
00491711   1/1  ----------------------------------------------------------------------
00512611   1/1  ----------------------------------------------------------------------
00525361   1/1  ----------------------------------------------------------------------
00469311   1/1  ----------------------------------------------------------------------
00528071   1/1  ----------------------------------------------------------------------
00490741   1/1  ----------------------------------------------------------------------
00476561   1/1  ----------------------------------------------------------------------
00450601   1/1  ----------------------------------------------------------------------
00511031   1/1  ----------------------------------------------------------------------
00518851   1/1  ----------------------------------------------------------------------
00502341   1/1  ----------------------------------------------------------------------
00491221   1/1  ----------------------------------------------------------------------
00484901   1/1  ----------------------------------------------------------------------
00509881   1/1  ----------------------------------------------------------------------
00497191   1/1  ----------------------------------------------------------------------
00473291   1/1  ----------------------------------------------------------------------
00498851   1/1  ------------------------------------------darlllglllglslllleayldlvldee
00518421   1/1  ----------------------------------------------------------------------
00530771   1/1  ----------------------------------------------------------------------
00463541   1/1  ----------------------------------------------------------------------
00468401   1/1  ----------------------------------------------------------------------
00512391   1/1  ----------------------------------------------------------------------
00468381   1/1  ----------------------------------------------------------------------
00511431   1/1  ----------------------------------------------------------------------
00499151   1/1  ----------------------------------------------------------------------
00486291   1/1  ----------------------------------------------------------------------
00516791   1/1  ----------------------------------------------------------------------
00446891   1/1  ----------------------------------------------------------------------
00494741   1/1  ----------------------------------------------------------------------
00473861   1/1  ----------------------------------------------------------------------
00501541   1/1  ----------------------------------------------------------------------
00474711   1/1  ----------------------------------------------------------------------
00495321   1/1  ----------------------------------------------------------------------
00509351   1/1  ----------------------------------------------------------------------
00415801   1/1  ----------------------------------------------------------------------
00502421   1/1  ----------------------------------------------------------------------
00421971   1/1  ----------------------------------------------------------------------
00507451   1/1  ----------------------------------------------------------------------
00518231   1/1  ----------------------------------------------------------------------
00451091   1/1  ----------------------------------------------------------------------
00430851   1/1  ----------------------------------------------------------------------
00445501   1/1  ----------------------------------------------------------------------
00475801   1/1  ----------------------------------------------------------------------
00467441   1/1  ----------------------------------------------------------------------
00415931   1/1  ----------------------------------------------------------------------
00509191   1/1  ----------------------------------------------------------------------
00519301   1/1  ----------------------------------------------------------------------
00479231   1/1  ----------------------------------------------------------------------
00484381   1/1  ----------------------------------------------------------------------
00472111   1/1  ----------------------------------------------------------------------
00474651   1/1  ----------------------------------------------------------------------
00526181   1/1  ----------------------------------------------------------------------
00521821   1/1  ----------------------------------------------------------------------
00379821   1/1  ----------------------------------------------------------------------
00526491   1/1  ----------------------------------------------------------------------
00514491   1/1  ----------------------------------------------------------------------
00516571   1/1  ----------------------------------------------------------------------
00409641   1/1  ----------------------------------------------------------------------
00516171   1/1  ----------------------------------------------------------------------
00366101   1/1  ----------------------------------------------------------------------
00476761   1/1  ----------------------------------------------------------------------
00390931   1/1  ----------------------------------------------------------------------
00408291   1/1  ----------------------------------------------------------------------
00403271   1/1  ----------------------------------------------------------------------
00413261   1/1  ----------------------------------------------------------------------
00531071   1/1  ----------------------------------------------------------------------
00465681   1/1  ----------------------------------------------------------------------
00488051   1/1  ----------------------------------------------------------------------
00426821   1/1  ----------------------------------------------------------------------
00350261   1/1  ----------------------------------------------------------------------
00520841   1/1  ----------------------------------------------------------------------
00494421   1/1  ----------------------------------------------------------------------
00518401   1/1  ----------------------------------------------------------------------
00519441   1/1  ----------------------------------------------------------------------
00505191   1/1  ----------------------------------------------------------------------
00507491   1/1  ----------------------------------------------------------------------
00478621   1/1  ----------------------------------------------------------------------
00528941   1/1  ----------------------------------------------------------------------
00487741   1/1  ----------------------------------------------------------------------
00532291   1/1  ----------------------------------------------------------------------
00531101   1/1  ----------------------------------------------------------------------
00490691   1/1  ----------------------------------------------------------------------
00527491   1/1  ----------------------------------------------------------------------
00473031   1/1  ----------------------------------------------------------------------
00529821   1/1  ----------------------------------------------------------------------
00520011   1/1  ----------------------------------------------------------------------
00530871   1/1  ----------------------------------------------------------------------
00506931   1/1  ----------------------------------------------------------------------
00485241   1/1  ----------------------------------------------------------------------
00491861   1/1  ----------------------------------------------------------------------
00527391   1/1  ----------------------------------------------------------------------
00369761   1/1  --------------------------------------------------------------elgrnlli
00405511   1/1  ----------------------------------------------------------------------
00367461   1/1  ----------------------------------------------------------------------
00525101   1/1  ----------------------------------------------------------------------
00526931   1/1  ----------------------------------------------------------------------
00432761   1/1  ----------------------------------------------------------------------
00379521   1/1  ----------------------------------------------------------------------
00423661   1/1  ----------------------------------------------------------------------
00383791   1/1  ----------------------------------------------------------------------
00513271   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           KGDIYDFLALVKGNTLSEALSFGMIWRGMARIIAARIKMRLPVNHNKSNVAHHYDLSAKLFDLFLDEDWQ
00401961   1/1  --------------------------------------Msk..kdlkeavaeyydlfadfydllldpnfh
00527091   1/1  --------------------------------------------------qnhYDlsndfyelfldpsmt
00478511   1/1  ------------------------------------------klkksfdnvakhYdlgndlyslildpdm
00496711   1/1  -----------------------------------------nsvsglfdsiashydllndlyellldedy
00479191   1/1  -----------------------------------------------------Ydlgndlyellldedyf
00479451   1/1  --------------------------------------------------etlgellklrlnklikeefd
00414441   1/1  ---------------------------------------------------------------------t
00497781   1/1  isyrrilkllspglgeayilglwkskdltdp.igdikrlieilyelyls..levlsklle....lilhfl
00466961   1/1  ------------------------------------------------------dlsndlyelyldlydl
00518841   1/1  -----------------------------------------dlikegdlvllllsrgnlllvllkllneg
00507621   1/1  -------------------------------------------------veehydelaefydkllgelli
00491711   1/1  ----------------------------------------------------------------------
00512611   1/1  -----------------------ellealnrklpltlrvnt.lkisreeilkhydlagkvydlfyivprg
00525361   1/1  ------------------------------------------lkvdkeeiakfydlaaeyydlvyatedg
00469311   1/1  -------------------------------------------------------------------erl
00528071   1/1  --------------------------------------------------------------------fd
00490741   1/1  -------------------------ledllrayllllpellllleslenladhldlgnppfelllgeeff
00476561   1/1  ------------------------------------------------------dlyndlfelfldhsse
00450601   1/1  --------------------------------------Ms.steklsplliehkelveefyd.......s
00511031   1/1  -------------------------------------------kllelldldidllklsllklkkinkly
00518851   1/1  ---------------------------------------------eldgqlldlllklikeklkknlgln
00502341   1/1  ----------------------------------------------------------------------
00491221   1/1  -------------------------------------mstvplselskklaeeffydlaadfydllld.g
00484901   1/1  -------------------------------------------lllldkllkllkpgdlvllllannlll
00509881   1/1  ---------------------------------------------kalldillwliellslglalslkid
00497191   1/1  ---------------------------------------llllralllllelvelllelleklldsllkg
00473291   1/1  -------------vkllkegdrvllelgrplmllellreggl.ldtrlgiepledllgvprglfldlavg
00498851   1/1  elerllellerlaerypllksllselndrdweeaylkglrpfrgldflvipavldprpdgerlvldpglf
00518421   1/1  ---------------------------------------------Mkekvkeyydelaerydllrgslp.
00530771   1/1  ----------------------------------------------------------------------
00463541   1/1  ------------------------------------------renlvdnlaehydllnevleallkvpre
00468401   1/1  -------------------------lslapllllllddvlleawlslldallegrldllellyglglfey
00512391   1/1  ---------------------------------------------------elydklaefYdkllgsrll
00468381   1/1  -------------------------edsllplllllldpllleallslleallegkydllellfgkelfe
00511431   1/1  ----------------------------------------------------------------------
00499151   1/1  ---------------------------------------Llvlgllielltpglrlllkvdelllsersk
00486291   1/1  ---------------------------------------------sydniaihydmlndrprt.......
00516791   1/1  --------------------------------------------------vlgnddyqeefdpealadef
00446891   1/1  --------------------------------------------Mveklirkhyildeevleaflkvpre
00494741   1/1  -------------------------------------------kngikdeilldyilsrprge.pldell
00473861   1/1  ------------------------------------------------------------------melf
00501541   1/1  ----------------------------------------------------------------dvaeyf
00474711   1/1  ---------------------------------------------ldgwfteilwpglrlllkldellhe
00495321   1/1  -----------------------------tigellrealalleeagldlldaelllllllgldrlrllll
00509351   1/1  --------------------------------------------------nmllelllklllllglnlse
00415801   1/1  ----------------------------------------mekkelldwiaelldlgldlykleaellld
00502421   1/1  ------------------------------------------------dvkdfydelaelyddlldelsd
00421971   1/1  ----------------------------Msdcplcpesltpsellykeevarvfdriaerydrlrpvpsp
00507451   1/1  ----------------------------------------------llvlllllllalnkalkllrdllr
00518231   1/1  ------------------------idcallaerlnkalellkdllkklevlrlilregdglpglavdryg
00451091   1/1  ----------------------------------------------------------------ddlakf
00430851   1/1  ----------------------------------------------msetetdfglarlklieeliashy
00445501   1/1  ----yeaqlelkknlleellkrlgptifsplplgyrnkaelvvrvdlkgdglglgfyekgskilvrieec
00475801   1/1  ----------------------------medleearkklvelllrnngilnlrvldalervprehfvpsl
00467441   1/1  --------------------------------------------ikrlvvllvlkglllsrlladalilv
00415931   1/1  -----------------------------------mevelmkilvtdpeelglvsklnekrlkaleeils
00509191   1/1  ---------------------------------------------------klleleedvrslfldyael
00519301   1/1  -------------------------vllslfaerlvealkllkklllkglvnayrlvlgegdllrglavd
00479231   1/1  ---------------------------------------------------------------------e
00484381   1/1  --------------------------------------------seildglvivgkydlskdlfeeflgd
00472111   1/1  --------------------------------------------------------nsdmsddefdpkky
00474651   1/1  ------------------------------------------------leddllplliryslpdwlvell
00526181   1/1  ---------------------------------------------------lqeitedllellfnallll
00521821   1/1  ---------------------------------------diteeelleyvlrhsfvpdpllllalrdeal
00379821   1/1  --------------------------------------melveklkedgvivvedvldafrlvsknlflg
00526491   1/1  ----------------------------------------------------------------------
00514491   1/1  ----------------------------------------------------------------------
00516571   1/1  ------------------------------------------------pedevkelirsfydraadrydg
00409641   1/1  -----------------------------------------------------wfterltpekafslkve
00516171   1/1  ----------------------------------------------------------------------
00366101   1/1  --------------------------------------------mserliklepekyillelkflglrfk
00476761   1/1  ----------------------------------------------------------------------
00390931   1/1  ---------------------------------------------------------eeffelfrdigkk
00408291   1/1  ----------------------------------------------------------------------
00403271   1/1  --------------------------------------------------dellrafldllealregepa
00413261   1/1  --------------------------------------------rskrvpleyilgeadfyglpldvgga
00531071   1/1  ----------------------------------------------------------------------
00465681   1/1  ----------------------------------------------------------------------
00488051   1/1  ----------------------------------------------------------------------
00426821   1/1  ----------------------------------------------------------------------
00350261   1/1  ---------------------------------------------------------------------n
00520841   1/1  ----------------------------------------------------------------------
00494421   1/1  -------------------------lpgllidrliqllgeelealleallealplllrvntlkisldell
00518401   1/1  ------------------------------------qvmlklikkqikeypqdklvripekaslyllvle
00519441   1/1  ----------------------------------------------------------------------
00505191   1/1  ----------------------------------------------------------------------
00507491   1/1  --------------------------------------------------------egeplriilgkleg
00478621   1/1  ----------------------------------------------------------------------
00528941   1/1  ----------------------------------------------------------------------
00487741   1/1  ----------------------------------------------------------------------
00532291   1/1  --------------------------------------------------------------lllgllwl
00531101   1/1  ----------------------------------------------------------------------
00490691   1/1  ----------------------------------------------------------------------
00527491   1/1  ----------------------------------------------------------------------
00473031   1/1  ----------------------------------------------------------------------
00529821   1/1  ------------------------------------------vsidfvrrflvkliekiilrswrgldii
00520011   1/1  ----------------------------------------------llletliellldlgrdllldervd
00530871   1/1  ----------------------------------------------------------------------
00506931   1/1  -------------------------------------------------------------llriiggkf
00485241   1/1  ----------------------------------------------------------------------
00491861   1/1  ----------------------------------------------------------------------
00527391   1/1  ------------------------------------------------------------ypmriiagkf
00369761   1/1  lgDnldvlkllpdgsvdlivtDPPYntgkdyndsledylefleerlkearrlLkpdgsifvfiddkelag
00405511   1/1  ----------------------------------------------------------------------
00367461   1/1  ----------------------------------------------------------------------
00525101   1/1  ----------------------------------------------------------------------
00526931   1/1  ----------------------------------------------------------------------
00432761   1/1  ----------------------------------------------------------------------
00379521   1/1  ----------------------------------------------------------------------
00423661   1/1  ----------------------------------------------------------------------
00383791   1/1  ----------------------------------------------------------------------
00513271   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           YSCAYFNPPDIGLYEAQVAKKRHIAAKLMTEPGQSVLEIGSGWGGMAMYIAESAGADVTGITLSEEQLRV
00401961   1/1  ysygyfsgefldleeaqerlldlllellglkpgkrvLDvGCGtGglllalakrygarvtGiDispemlel
00527091   1/1  yssgyfedpgesleeaqeakldllldklglkpgkrvLDiGCGtGglarylaerygarvtGiDlseemler
00478511   1/1  fysygyyddpdetlrpaqelllelllellglkpgkrvLDiGCGtGllalalakrvgarvtgvDispemle
00496711   1/1  fysygyfddyglglrpaqeallelllellglkpgkrvLDiGcGtGglalalakalgarvtgvDispemle
00479191   1/1  ysdayyddpgdllrpaqerllelllellglkpgkrvLDiGcGtGglalalakalgarvtgvDispemlel
00479451   1/1  lgnkfsklwldrs.vydsyyfeakllglyrsraalkleelleklglkpgkrvLDlGCGtGglalylakry
00414441   1/1  ysagyydlpadilrpateelldlllellglkpgdrvLDlGcGtGglalalaravgarvtgvDispemlel
00497781   1/1  nrnteegdlenilahydlgndllkrlipdgiglfldptmlyscalfeflleqvytravipdaeklrhyka
00466961   1/1  yssaydllgdrpltda...lleallellglkpgkrvLDlGcGtGglalalakr.gakrvtgvDisp.mle
00518841   1/1  gvlntrygvlkhddligklygsfldsskgysvallrpapedltlllkrgtqivqpkdialilelldlkpG
00507621   1/1  p............rpateellelllellglkpgkrvLDlGCGtGrlalalakr.gpevtgvDispemlel
00491711   1/1  ------skyy..wdefyrplldallellglkpgkrvLDlGCGtGglllalarl.gagevtGvDiseemle
00512611   1/1  efllldptledsvlifkrgteilqpa...dlalilellglkpgdrvLDiGcGsGgltlalarlvgpegrv
00525361   1/1  ylgglflfngadleesaefladlllellgllpgkrvLDvGcGtGrltlallarlgaevtgvDlseemlev
00469311   1/1  fdeyaefydlanglglrprqeallelllellplkpgkrvLDlGcGtGglalalak.lgpkrvtgvDisp.
00528071   1/1  syayfydalnllqlrprtealleallellglkpgkrvLDlGcGtGglalalakr.gakrvtgvDisp.ml
00490741   1/1  eyfakvyelydafndglrpatrlllelllellglkpgkrvLDiGcGtGglalalakalPgarvtgvDi.p
00476561   1/1  yalinqlllee........lvellldlldlkpglkvLDiGcGtGelalalakklpalfpsigakvtgvDi
00450601   1/1  laerydelrgvllrpaqrallelllellgllpgkrvLDvGCGtGllslalaer.gaeVtgvDiseemlel
00511031   1/1  knlknlilkntsnvskeeiakfydlvadff....devaayydglfg.dllslrpaqeellelllellplk
00518851   1/1  ldllplgegqyieelwpglalslkvdevlhekkskyqiiriydlgndgrrlfldggvqysr.........
00502341   1/1  ---------------al..klelllellglkpgkrvLDiGcGtGglalalakrg.arvtgvDispemlel
00491221   1/1  lfpsqrel..............ldlllellglkpgkrvLDlGcGtGglalalakr.garvtgvDispeml
00484901   1/1  pltlrvnklkltrfgllnvlelsgknavahydlsndvyellldpaysdslarfgegntll...qpelael
00509881   1/1  klleeekskyqiiriydlgnfgyelfldgrllys.........rldeaqytelllllllldlkpgkrvLD
00497191   1/1  eipfeyllgedffeyfdddaely.....dgfndglsgaqelllelllellplkpgkrvLDiGcGtGglal
00473291   1/1  ylvlilrpltedlveafgrgtqitqpavaalllellglkpGarVLDlGcGtGaltlalaravgpggrvva
00498851   1/1  fgtglhptt.........elllellakl.lkpgdrVLDlGcGtGtlaialakl.garvtgvDispealel
00518421   1/1  ............lrpaaealldlllellp..pggrvLDlGcGtGrlalalaer.gaevtgvDispemlev
00530771   1/1  --keyydeiaerydpaqrallelllellgllpggrvLDlGCGtGrlalalarr.garvtgvDlspemlel
00463541   1/1  lflpevplrelayedeflpitlevgegllisqpetlalllellglkpgkrvLDiGcGtGylalalarlgg
00468401   1/1  laldaevydafldglrpatellldlllellglkpgkprvLDiGcGtGglalalakrlPgarvtgvDi.pe
00512391   1/1  y................eelldlllellpelllkgkrvLDlGCGtGrltlalakr.gakvtgvDiseeml
00468381   1/1  ylagdaelydlfndglrpgserlldlllellpllkpgkrvLDiGcGtGglalalakalPgarvtgvDi.p
00511431   1/1  ------------------qrellelllellglkpgkrvLDiGcGtGglalalakrgp.rvtgvDispeml
00499151   1/1  yqeirvyelgddgrvllldgllqgssld.........erqrallllllallglkpgkrvLDiGcGtGgla
00486291   1/1  .................ealleallellgllkgkrVLDvGcGtGilslalaka.GakkVtgvDisp.mle
00516791   1/1  yalaseydpldrllllllerllell.slglkpggrvLDvGcGtGllalllaarlgarvtglDlspamlee
00446891   1/1  lfvpeplyslayfdglealkflgqnflsapellalllelldlkpgkrVLDiGcGtGyltlllaklgg.kv
00494741   1/1  deyedyalkfglglliiqpellalllelldlkpgkrvLDiGcGtGglalalakllppgakvtgvDispea
00473861   1/1  devaeryddfadglspgqdrllelllellaellkpgkrvLDiGcGtGglalalakllgepgarvtgvDis
00501541   1/1  ddiaavydgfaeglreaaeallelllel.lp.pgkrvLDiGcGtGglalalakr.garvtgvDispemle
00474711   1/1  ekskyqiiriydlgndgrvllldglvlgsrpd.........eaqerllllllallplkpgkrvLDiGcGt
00495321   1/1  lllplsvlelllllellerrllgepveyllgerefyglafkvgggvftprpttelllelllellpkpgkr
00509351   1/1  eqyekledyfdllldwnkkynllsskdpd.rlwerhildsllllelldlkpgkrvLDlGcGtGllaiala
00415801   1/1  evlgldraglllgdrgltleelakflelierrlegepleyllglyeflglefgtgpgvfiprpttellle
00502421   1/1  ..................alldlllellglkpgkrvLDiGcGtGglalal.....grvtgvDispemlel
00421971   1/1  lyyllgddeeayldlllfpgagiprplaelllelldelllkpgkrvLDiGCGtGylalalakllPgarvt
00507451   1/1  klglpayrlvlgegdllrglavdrygdwlvvlllselgleelealleallellppidlrvnklkisreel
00518231   1/1  dwlvvlllealgeeeleelleallellpelrvnllkisredlleelldelielllgerdllgelyenglr
00451091   1/1  lgqnfltdp.........ellelilellnlkpgdtvLDiGcGtGaltlalaklgp.kvtgvdiseemlel
00430851   1/1  dlsvdvlealldvpreyfvlepayedlalafgtgvhilrpellalllellledlkpgarVLDiGcGsGyl
00445501   1/1  pildeillellprlrellsrldeltkegllrllllrsgelllllvdkpldedveealkalydlfddiyrl
00475801   1/1  lgylafldlplafgegvlisqpel........lalllelldlkpgdrvLDiGcGtGylalalaklvggrv
00467441   1/1  prhydlgedlygeelakvyddlaafldg....lrsrqeallelllellglkpgkrvLDlGcGtGglalal
00415931   1/1  viqnvneelleailavlrrvllpsngkdfaeiaalydlyndsyesfyqlnagqallldegmlipraltem
00509191   1/1  ydgdnllleelgdgvmraqeralmallallglrpggrVLDvGcGtGglalalaeagpeevtgvDispeml
00519301   1/1  rypdwlvvlllsalgeeelealleallellp.dlrvnllkisreeklllrreeilpllpetlleeflglr
00479231   1/1  fydd.yalsfdeglrptqeellelllellglkpgkrvLDlGcGtGglalalaklgp.kvtgvDispeale
00484381   1/1  ydl.....vlafldglrsraerllelllellglkpgkrvLDlGcGtGglalalakllgagrvtgvDispe
00472111   1/1  ldefyddyagrffrlreilrllldellallgllpggrvLDvGcGtGllalalaralppga.rvtgvDlsp
00474651   1/1  ldllgeeleallealllplpldlrvntlkisleellelleklgvvleaydllgdpleyllglrefyslpl
00526181   1/1  ienlldgaldalleilpellgllflldlllddellrelldllseidlseidydilgelyeyllgefaglr
00521821   1/1  dvg.......gglpilspekgalllellrllpgkrvLdiGtGtGysalalaralppgarvvavdispeal
00379821   1/1  ervygegvvkpqdegatiwaphrsrlaaklaeilelldlkpGdrVLDlGcGtGgltlhlaklvgpeGkvv
00526491   1/1  -----------ddlyddglsliqrellelllelldlllkpgkrvLDiGcGtGglalalakllpgakvtgv
00514491   1/1  -----GadeyfefgpryiqepllelllelldlllkpgkrvLDiGcGtGglalalakllpgakvtgvDisp
00516571   1/1  qnrlleelgd.gvmlaqerallrllallglrpggrvLdvGcGtGllalalaeagpaevtgvDispemler
00409641   1/1  evlyeakseyqqiflvdsevfgkllfldgvlqsterlefpyh...........ealahllllnlkkgkrV
00516171   1/1  -------------QnfltdpalldailellglkpgdrVLDiGcGtGaltlalakr.garvtgvDispeml
00366101   1/1  vdpgvffptgldldt......elllelldlkkgkrvLDlGcGtGilaialakrga.kvtgvDispealel
00476761   1/1  -----------lldllsllllelglvlsdeqleklealldllldwnpvinltgsrefdelwlrvlldlla
00390931   1/1  ydgwyfeep.llpglalsykvdrvlhegkspyqeililespdfgrllvldgvvqlserleliyhealahl
00408291   1/1  ---------vlipfehqevlleellellklkpgkrvLDlGcGtGglalalakllpgarvigvDispeale
00403271   1/1  felafgkdffeylakdpdlalrflggmralsellldellealpdlsggkrvLDvGcGtGalllalakkyP
00413261   1/1  ....fltprpitellleallel......gllkgkrvLDlGcGtGilaialakl.GaakvtavDispeale
00531071   1/1  --------------------GplriilgefrglklkvdpgvlirpttdrlrelllelladllkgkrvLDl
00465681   1/1  -----------gyvsrgalklqelleklgllkpgervLDlGcGpGgltlvlaervgpggrvvavDlsp.m
00488051   1/1  ----------vnvlkidseevleallkegrellltpglvpgksvygedygdplgeearlwdprrsrlaak
00426821   1/1  -----------qnfltdpeilekilelldlkegdrvLdiGcGtGaltlelakrgg.kvtaieideemlel
00350261   1/1  vTsffrdpehfdalaelllpll.........pglrvLdlGcGtGeepyslamlllealalag.pgarvta
00520841   1/1  -------------elvlsslmdaefWderydegetgfdlgepnpllvefleallglpkggrvLdlGCGtG
00494421   1/1  elleglgielrllpllplayilgerlefallpgfktglfltqrevsellaelldlkpgerVLDlgcGtGg
00518401   1/1  alltg.................lnllqrllaafllelldlfkgkrvLdiGaGtGllllalaellppgaev
00519441   1/1  -----------slprwlvinllkllgeellealleallellplvlrvnellaelgielerdelgppllyl
00505191   1/1  ---------------------lHipvlleellellapkpggrvlDlgcGtGghslalaerg.grvigvDi
00507491   1/1  lklkldpgqafltprpvtellvdallelgllkgkrvlDlGaGtGalslalakr.gakkvvavDidpeale
00478621   1/1  -------llelkwieelkkklgvvdervldrlreikfddivpegeyyglpllisrglttsspelasylva
00528941   1/1  -----------------------------ylgdydklrllrsnlaeqllsllalrrglrilDlGcGtGal
00487741   1/1  -----------------------------hqnfvnpllakllealdlrpgdrVLdlgcGtGrlalaLakr
00532291   1/1  tetltpglalslkvdevlyeekspyqeivvvesgdfgrllfldgvvqster....defiyhemlah....
00531101   1/1  ---------qtglrpdtrllrealaaalaglakgkrvLDlgcGtGglslaaaka.gaeVtgvDispeale
00490691   1/1  -------------QnfltdpnlldkivelldlkpgdrvLEiGcGtGaltlaLakrg.akvtavEidpdll
00527491   1/1  ----kldpgkfyfsnglrperlrvlel..lkpgetVlDlgaGiGilalpaakl.gakkVvaveidpeave
00473031   1/1  ---------------------prellkeflkakkslgqnfltdpnladkivelldllpgdlnleglrvLe
00529821   1/1  lsagylipgilgregteqlldsalilemlqelkglsvldiGcGtGtlailllrlgparrvvavDispevv
00520011   1/1  dylrdlikglpeallaledfadllykyaylfswrgrliiklpedgallrlllaelkpkriLElGcgtGgs
00530871   1/1  ----fyTPreivellvelld.........pkpggrvlDpgcGsGgfllalaerllpgarvvgvDidpeal
00506931   1/1  rgrkllvpp..gprptterlrealfnllllllleggrvLDlgaGsGalaleaasrga.evvavDidpeav
00485241   1/1  ---------------------aallrllgldpg.tvlDpgCGsGtllieaalaarrpaarviGvDidpaa
00491861   1/1  -------------dklvtallvlaarakesarpdgylpslklDpyaaylvdriaaealrlllgldlflrl
00527391   1/1  rgrkllvppglftrpttdrvreallnilapllpgarvLDlgaGsGalgleaasrgaarvtaveispeale
00369761   1/1  lkllldeifglealedlgfnllneiiwdkpngvparkrfalahEyilvfskggk.ylfnldgrrlrptte
00405511   1/1  -----lsleeaaallcagltayhallragllpgktvlvtGaGgvGlaaaqlaaalGarViavdrseekle
00367461   1/1  --------------lellsvalhallraglvpGktVlviGaGgiGlaaalaakalGakViatdrspekle
00525101   1/1  ---------------------ladvlanvlldirksekvldlGcGtGlllialael.garkvyavDlspl
00526931   1/1  -------------------------------egkrvLDlfaGsGalgleaasrgaakvvavdispealel
00432761   1/1  -----lplelaaalglalltavlavlaagvkpgktvlvlGaGgvGlaaaqlakalGakVvavdiseekle
00379521   1/1  ------------------------lielstkpgdlVlDpfcGsGttaia.aaklgrkvigididpeavel
00423661   1/1  ------lplelgalvltlatavralllagvlpgakVlvlGaGvvGlqaaalakalGageVtvvDisperl
00383791   1/1  -------pkdvdlrvllllpeigltalealkrallelkpgsrVlviGaGgvGsaaaqllaaaGvgkvilv
00513271   1/1  ------------------------------kpgdtVlviGaGgvGllaiqlakalGagrViatdispekl


                         -         -         -         +         -         -         -:280
query           SRDRAAKRGLAGNVRFELQDYRYLPASKKYDRIVSVGMFEHVGPTHYRDYFDKVAEVLDDKGVMVLHSIG
00401961   1/1  areraaelglpnrvefvqgdaedlp..dsfDlvvsnevlhhlgpedleaalkelarvLkpGGrlvlstin
00527091   1/1  areraaeaglsnrvefivgdaedlp..gsfDlvvsievlehvgpedleaflkelarvLkpgGrlvlsdpn
00478511   1/1  larenakenglpnrvefivgdaedl..dgsfDlvvsngvlehllleggldglpdpekalkelarvLkpGG
00496711   1/1  larenaaelglpnrvefvvgDaedl..dgsfDlvvsnavlhhlpvedpeallrelarvLkPGGrlvlsep
00479191   1/1  areraaelglpnrvefvvgDaedl..dgsfDlvvsnavlhhlpledleallrelarvLkPGGrlvlstpn
00479451   1/1  pgakvtgvDispemlelaren.krlgl.dnvefiqgvda.lpfpdgkfDlvvsDppfsgvlhhvpdpell
00414441   1/1  areraeelglpdnvefvvgDaedlfpdgsfDlvvsngvlhhlpd..peallrelarvLkpGGrlvlsept
00497781   1/1  fseevygeaqpnklseileklglkpgdtvlDlGcGtGnlaiqaAleyGakkvvGidispeaielakenlk
00466961   1/1  larenaaenglpnrvefivgDaedlplpdgsfDlvvsnpsgvlhhlpde.leallrelarvLkPGGrlvl
00518841   1/1  drVLDiGtGsGgltlllarlvgpkGrVigvdiseemlelarenlkrlgldlhleklgyaldnvefilgda
00507621   1/1  Arerakengl..nvefiqgDaedlpfdgsfDlvvsnpnvlhhlppedlekllrelarvLkPGGrlvlstp
00491711   1/1  lArerakeaglsdnvefivgdaedlpefpdgsfDlvvsnfvlhhlflspedleaalreiarvLkPGGrlv
00512611   1/1  tavDiseealelarenlerlglddnveviqgDaedplpdgsfDaivs.......dlpdpwelleelarlL
00525361   1/1  arerlaeagl.prvefvvgdaedlpfpdgsfDlivssevlhhlsdedlaaflrelrrvLkPgGllvisdp
00469311   1/1  mlelarenaaenglpnrvefivgDaedlleplpd.fDlvvsnPpggvlhhlpd..leallrelarvLkPG
00528071   1/1  elarenaaenglpnrvefivgDaedlplpdgsfDlvvsnplpfvlhhlp..dleallreaarvLkPGGrl
00490741   1/1  emlelarenaaelglspnvefvvgDaed.plpdsfDlvvsngvlhhlpdpdleallrelarvLkpGGrlv
00476561   1/1  seemielakerakelglsdnvnvefivgdaeellleqlepfedekfDliisnnvlhhv..pdleaalkel
00450601   1/1  AreraaengldpgadnvefvvgdaedlpellfpdgsfDlvvsnfgvlhhlPpyfldpedleaalrelarv
00511031   1/1  pgkrvLDiGcGtGglalalakrlgarvtgvDispemlelarenaaelgl...vefivgDaedlpfpdgsf
00518851   1/1  lderqleelllllalldlkpgkrvLDlGcGtGglalalakrgpdarvtgvDispealelarenlaengla
00502341   1/1  areraaelgl.pnvefvvgDaedlpfpdgsfDlvvsnavlhhl..pdpeallrelarvLkPGGrlvlstp
00491221   1/1  elarenaaelglsdaddnvefivgDaedlplpellledgsfDlvvsnfavlhhlptgrrdpedleallre
00484901   1/1  llelldlkpgkrvLDiGcGtGglalalakllgpdarvtgvDispealelArenakrlglddnvefivgDa
00509881   1/1  iGcGtGglalalakrgpaakvtgvDispealelarenlkelglslddpnvefivgDaedllkplpdgsfD
00497191   1/1  alakalpgakvtgvDi.pemlelarenakelglpnrvefivgDaed.plpdgfDlivssgvlhhlpdpel
00473291   1/1  vDispealelarenlaraglalpdnvevvvgDaedlplpdgsfDavvs.......dlpdpeaalaeaarl
00498851   1/1  Arenaarngl.dnvefvqgdaedlp.dgsfDlvvsnpplehlpd.....llaeaarlLkpGGrlvlvein
00518421   1/1  arer.......gnvefvvgdaedlpfpdgsfDlvvssfgvlhhl..pdpeaalrelarvLkPGGrlvlst
00530771   1/1  areraaaagl.dnvefvvgdaedlpfdgsfDlvvsngvlhhlppedleallaelarvLkpGGrlllstpn
00463541   1/1  pdgrvvavDispealelarenaerlgl.dnvefilgdaedllfedgsfDlvvsdapleh........lle
00468401   1/1  mlelarer.......pnvefvvgDaed.plp.sfDlvvsngvlhhlpdpeleallrelarvLkpGgelGr
00512391   1/1  evArerakeagl..nvefivgdaedlpfdgsfDlvvsnfnvlhhllseedlekalkeiarvLkpgGvlvi
00468381   1/1  emlelarer.......pnvefvvgDaed.plp.sfDlvvsngvlhhlpdpeleallrelarvLkPGGrlv
00511431   1/1  elareraaelglpn.vefvvgDaedlpfpdgsfDlvvsnavlhhl..pdpeallrelarvLkPGGrlvls
00499151   1/1  lalakr.pegarvtgvDispealelarenlaelglgllddpnvefivgDaedflpfldgsfDlivsdppl
00486291   1/1  larenaklngldnrvefiqgdaedlplpdekfDlvvsnpvlhhlpnesdlekllkelkrlLkpgGrlils
00516791   1/1  arkrlaelgladdwsplvkvvcelegklllleeleellrdlvnvelvvgdaedlplpdellgsfDlvvss
00446891   1/1  tgvDiseemlelarenlkeng...nvefivgDaeelpfpdesfDlivsnaplhhl........leellrl
00494741   1/1  lelarenakenglpnrvefivgdaedflpfllaeglldgsfDliv.sdalh....pdlpklleelarlLk
00473861   1/1  pemlelareraaelglsdnvefvvgDaedlplpd.fDlvvsnavlhhlpdpdleallrelarvLkpGGrl
00501541   1/1  lareraaelgl..nvefvvgDaedlpfpdgsfDlvvsnavlhhlpdedleallrelarvLkPGGrlvlst
00474711   1/1  GglalalakrgpdarvtgvDispealelarenlalnglelglpnvefivgDaedflpfldgsfDlivsdp
00495321   1/1  vLDlGcGtGglalalakllpgarvtgvDispealelarenaalngl.dnvefvqgDaldplpdgsfDliv
00509351   1/1  klfpgakvtgvDispemlefarenakklgl.dnvefiqgdaedlpfellldgsfDlivs....rhvad..
00415801   1/1  lllellglkpgkrvLDlGcGsGllaialak.lgaakvtgvDispealelArenaelnglsnrvefivgda
00502421   1/1  arer........nvefvvgdaedlpfpdgsfDlvvssavlhhl..pdpeallrelarvLkPGGrlvlsep
00421971   1/1  gvDispemlelArera......gnvefivgdaedlpfpdgsfDlvvssfvlhhl.d........elarvL
00507451   1/1  gepvelllgelpeelyvqflglkfkvdpgvffrpgtellv......elllelldlkpgkrvLDlGcGtGg
00518231   1/1  flvdpdgfgtglfptqellaelllelld..pgkrvLDlGcGtGglalala.klgagrvtgvDispealel
00451091   1/1  akenlkeng...nvtfihgDalelpfpdgkfDlivsNpPynistavlehlpdleelrrlvlmlqleealr
00430851   1/1  tlalarlvpelgkdpggrvvgvDispealelarenlerlgldlllpdnvefivgdaedlpfpdgsfDlvv
00445501   1/1  ylgepleylagefeileeenglrflvdpggffqtnrpaterlvelllellglkpgdrvLDlGCGtGgltl
00475801   1/1  tavdispealelarenaerlgl.dnvevilgdaeellfedgsfDlvvsdaplph........lleellrl
00467441   1/1  akllgagrvtgvDispealelarenaa..glpn.vefivgDae.dplpdlleegsfDlvvsd..lphvp.
00415931   1/1  lldlvysltvpdarklnhyisfsdevygetspelvaelldlldlkpgdvvlDiGcGtGglalalAkltga
00509191   1/1  erareraaelg..pnvrvlvgdaeellpplpdgsfDavlsDppgssevlhhvp..dleaflaeaarlLkP
00519301   1/1  fkvdpgvf..fqtglfptqelllelllell..kpgkrvLDlGcGtGglalalakl.gakkvtgvDispea
00479231   1/1  larenakelglddnvefivgDaedlplpdgsfDlivsdpplhhlpd.....llkellrlLkpGGrlvlst
00484381   1/1  alelarenakrlg...nvefivgDaedlldlplpdgsfDlvvsd..lphlpdp..eallreaarlLkpGG
00472111   1/1  ealelarerlaeaglafdwspllkvvlelegnlelleeleellradrvrfvvgdaedlppllalplpdgs
00474651   1/1  fkd...glvltqdavsellvelldpkpgdrVLDlGcGsGglalalaklvgpagrvvavDispealel---
00526181   1/1  fklgefytprpvtel.........lvelllpklgdlkglrvLDpgCGsGgllialakrlpnaggae.vtl
00521821   1/1  alarenleaaGledrvtvilgdaedllpqllaplpdgkfDlifldaplehlpd..llell.ealrlLkpG
00379821   1/1  gvDispemlelarenleklg...nvefilgDaeelpkyllpdgsfDvilsdaplshlpde....aleeal
00526491   1/1  Dispemlelarenakelglpn.vefivgDaedlpellpdgsfDlivsnpPypwpgvlhhlpdellekllk
00514491   1/1  emlelarenakelgl.pnvefivgdaedlpellpdgsfDlivsnpPypsgvlhhlpdpllqeellkelar
00516571   1/1  areraaeag..pnvrvlvgdaedllpplpdgsfDavlsDppsevlhhvrrpdpeaflreaarvLkPGGvl
00409641   1/1  LdiGcGtGglarellkh.gaaevtgvdidpevielakenlklnglsvlnagalddprvevivgDalellf
00516171   1/1  elareraaengladnvefiqgDaedlplpd.fDlvvsnlplhhlpd..leavlaelarvLkpgGrlvlse
00366101   1/1  akenaklngldnrkvefiqgdaedplpdgkfDlivsnppy.llgledleklleeaarlLkpgGilllstn
00476761   1/1  llplkpgkrvLDlGcGtGllalalakllpgarvtgvDispealelarenaaelgl.dnvefvvgdaedl-
00390931   1/1  lllllkppkrvLdiGgGtGglarellkhgpvakvtgvdidpevielarenfklnglalddprvevivgDa
00408291   1/1  larenlkelg..dnvefiqgdaldlpellllfpdgsfDlilsDpPysslgllifvlhhl..edleeflee
00403271   1/1  gakvtgvDlsp.mlelaren.......prvefvvgDafd.plp.sfDlivsswvlhhlpdeelvkllkea
00413261   1/1  larena......gnvefivgdaeelp..gkfDlivsNPPyvplsdilllevldleplsallehldd..le
00531071   1/1  gcGtGglalalak.rgakkvtgvDispealelarenaklngldednvefiqgdaldflplllldekfDli
00465681   1/1  lelar...........vefiqgdardlplldlllellpdgsfDlvlsdaplshlgdlrrdlarlaalqla
00488051   1/1  lalilellglkpGdrVLDlGcGsGgltlhlaelvgpeGkVygvDispemlelarenleelg...nvefil
00426821   1/1  akenlkelg...nvefiqgDalklpfpdgkfDlivsNpPynissavlhhl..edlekarrltlmlqleea
00350261   1/1  tDispealekareglyplgllrglplellkryflkllgadgglyrvkpelrdrveflqgdlldlpppldg
00520841   1/1  rdalwLaer.GfdVtGvDisetalelareraklaglvtrlgeleggklflysgpnitfvqgdlfdlpfap
00494421   1/1  ltlalaklvgaagvvavDispealelarenaelngl..nvefivgDalellkllpdgkfDlillDPP---
00518401   1/1  tgiDidpdalevarknlkrlglpkrvrlvvgdaldalpalaegvedgkfDliildfvlehlad.....l-
00519441   1/1  lggvefadlplyktgvfitqdeasallaelldlkpgdrVLDlgaGsGgltlalaelvgpggrvvav----
00505191   1/1  dpealalarerlaglgllnrvefvqgdalalplpdgsfDgvlldlglsslgldradndeledlaeale--
00507491   1/1  larenaelngl..nveviqgdalelp..gkfDlvvsNPPyiitskillklllklepelaldvledlld..
00478621   1/1  alvddlnpgekvLdvGcGsGlllallaeaigvagkvlgvDidaevldlaednlkknglsllssgnvelvv
00528941   1/1  llalaevlppdvrvvgvDiseealekarqrlganpl..niefivgdalqlplpggfDlilsnfvlehl..
00487741   1/1  .garvigvDispealeqarenaelnglvsevgdllvysadnvefivgDafdlppadlgsvdlvldraalh
00532291   1/1  .lllllhpnpkrvLdiGgGtGglarellkhlpvekvtavEidpevielarkyfpllglalddprvevvvg
00531101   1/1  lareNaalngleddnvefiqgDafeflkrlakegekfDliilDPPyfglgkkgevld..glrdlrellel
00490691   1/1  ellkerlkelg...nvevingdalkldlpdlllelekfdlvvsnlpynistd..illkllellrllkpgg
00527491   1/1  llreNaklnglenrvevingdardllpeekfDvvvldppasg......lellkaalkllkpggivyvsc-
00473031   1/1  iGcGtGaltlaLlkrlgakkvtavEidpdmieilkerlk....gpnvevingDaldldelllllpddf..
00529821   1/1  elakkrlqalglenrvtfilgdaldilrdllellsdgsfDvvvldPPfisslpllalgvlehlpdpdaai
00520011   1/1  llllaealkllgpdgkvvgiDispemlevar......glldnvtliqgdaldlpflekllelgsfDlvfi
00530871   1/1  elaren..........eivvgDalellpdesfDliiaNPPyggsgdldrlldellkrlydelalal----
00506931   1/1  alarenaerlglenrveviqgdafellaalpgesfDlvvldPPygldglellllllaa..rllkpg----
00485241   1/1  lelArrnlallgladllllesasellsslleklslldlllaldlleelllgelktlrvevvqgDal----
00491861   1/1  lagellklldrdfpginrgyaaRtrfiddlvrrflaegpraqvldLGcGldtrafrlaerppgarvvevD
00527391   1/1  larenaallgl.dnveviqgdaleflpelgekfdliflDPPyaggll......dlllllllalrll----
00369761   1/1  rvkellfnglilfkkeedgkpptdvweiplvsgla-----------------------------------
00405511   1/1  larelgad..vvidvtdedlveavleltggvDvvvdaagvpa........tleealrllkpggrlvlvgv
00367461   1/1  qakelgadfvvvykdl..........sediieavaellatngggadividtagipg...ileeavdllkp
00525101   1/1  alelcrknlallglddrvkvvhgdlldlldleessfDlilldppysllilell..dvllsaa.rvLkpgG
00526931   1/1  akenaalnglenrvevirgdalellkallkegekfDlvvlDPPyfa......glllyllllllalkllkp
00432761   1/1  lakelGadfvvvykd.edvaeavleltg.gadvvidtagipg........ilreilrllkpggvivllgl
00379521   1/1  akerlkk---------------------------------------------------------------
00423661   1/1  eqaeelGadlvvvpse.edlaeavreltgkqgggaDlvitaagipg........vlrealevmkpggvvv
00383791   1/1  Drdeealerarrlgpdvvvdpie.dlaeallellggrgvDlvldcvdnf........etlallidalkpg
00513271   1/1  elakelGadhvinyrdedlveavleltggrgvdvvidavggea........tleaalellkpgGrivlvg


                         -         *         -         -         -         -         +:350
query           QPYPALATNPFIEKYIFPGGYIPSLAEVLPAIQKSGLLVKDIEILPMHYAHTLRHWRERFVARKAEAVAL
00401961   1/1  ledleelrealeflgllprrlhdfikryifpggrlptpeeleelleeaGfevvevedlgphyaltlelwl
00527091   1/1  rpdlleleelllllpretlrlgdfikkyifpggrlptleellelleeaGfevvevedlglhyartlrawl
00478511   1/1  rlvistpnredlsellalllkllleveellpflykydfphgrflspeeleelleeaGfevvevedlglhy
00496711   1/1  nrpdleelrllglllgeellelldlllrgiepggrlltleelrelleeaGfevvevedlplpyastledw
00479191   1/1  rdgleellelllllllellelldlllkeippggrfltleelealleeaGFevvevedlpldyaltlrdwl
00479451   1/1  ellkeaarvLkpGGrlvlstftlfeeeneelleilkklfpgvllpsp.asrkgnseaylvakgfknlglh
00414441   1/1  legeepeelldfilryifpggfls.leellalleeaGfevvevedltagvvevlrlhyaltlrlwleanl
00497781   1/1  elgkllelfgkklenrvefilgDfldlpfedlligsfDvvfsnnllfdpdllkalkell-----------
00466961   1/1  stps.ppllpeelelllkellpggp.dvegfdlelleeagfe..dvevlgldyartlseplelfsfdfle
00518841   1/1  eellkllpdgsfDavfl.......dlpdpeealeellrvLkpGGrlvifvpti.eqverlleflreagfp
00507621   1/1  npegleellalllallllelvllvdllpetdrlekvvllelllllkgdlevvrllleslplrll------
00491711   1/1  lstpnpddllellellrflerlylllfglleplllllgaryifplgdgvdpvherllsleelealleeaG
00512611   1/1  kpGGrlvlstptieq.....................leellelleeaGfevveveellpryartletwlr
00525361   1/1  vlpd.......dlrlddlpggrfrtpeelrelleeaGfevvevedlpglpavllavkryal---------
00469311   1/1  Grlvlstpnrpglpellelllaelleifpgvggfdlsellell......leeagfegvdyerllepplel
00528071   1/1  vlstp.sppgleellellralllekllfvgg.fdledlvelg..flevevlrldyartleeplelfgfdl
00490741   1/1  lsepvrpdleellellgllldlllyifpggrfrtleelealleeaGFevvevedldlgylpglfrvi---
00476561   1/1  yrlLkpgGklliiepsgdslleklfgelpklidgrpggrflsleelielleeaGfkvvdie..glsyddi
00450601   1/1  LkpGGrlvlstpnredlallralleaylrdllpelgglvvsdvlylrllgesvlleallkllpa------
00511031   1/1  DlvvsngvlhhlpdpelkkllkelarvLkpGGrlvistpnrdd.....ldflll.ipphgr---------
00518851   1/1  lddpnvefivgDaedflpfpdgsfDlivsdpplhhlpdpdllqeefleeaarlLkpGGrlvlstpsppld
00502341   1/1  nlp.dlellrlllalllrlldppggrfrspeeleelleeaGfevveveelplplaltlllkllrllkkll
00491221   1/1  larvLkPGGrlvlstpnpddleellellldlgllvlpelgrlvaldlllleellesidlel---------
00484901   1/1  edplpdgsfDlivs.....dpp..dpeelleellrlLkpGGrlvlsepspedleellellkeag------
00509881   1/1  liisdpplhhlpdphllteeflkelarl------------------------------------------
00497191   1/1  ekllkelarvLkpGGrlvisepnrpdesylrellglldllllifpggrfrtleeleelleeaGFevv---
00473291   1/1  LkpGGrlvlseptl.eqlaellellraaglfvllevledlarrprvrflt--------------------
00498851   1/1  pe.....................tleellelleeaGfevveveeldgfpattlvk---------------
00518421   1/1  pnreslpelrelllaylllkllfpelgyrlldpshlrflspeellalleeaGfevveveeltlplallll
00530771   1/1  rldl........rkglppplrllsleellelleeaGfevveveeltlgllltllllrllvflllva----
00463541   1/1  ellrlLkpGGrlvlstilleg.....................leellelleeagfev-------------
00468401   1/1  lllsepvrpdlpelrlllllellfdllllfpggrlrtpeelralleeaGFevveve--------------
00512391   1/1  stlnpedlpellaileleellglvprilkyifeggllpsllelllalgglverlgesvrlrflt------
00468381   1/1  lsepvrpdleelrlllllrllldllllifpggrlrtleelralleeaGFevvevepl-------------
00511431   1/1  tpnrpdleelrelldllerlllpghgrflsleelealleeaGfevveveelplpl..tllsllellrelk
00499151   1/1  hhlpdpeldrLlqeeflreaarlLkPGGrlvlstpsppdgrlelleellealrel.fpvvrlvfvpvpkv
00486291   1/1  ditlylapiedeelllervlfwpdvygfdl.dllekagfevvrvlsvdpnlllsepfllldfdlptptle
00516791   1/1  fvlehvceglddlraalaelarvLkPGGrlvlstilrlpl.....ylvgglgfpggf.lseee-------
00446891   1/1  LkpgGrlvlvdgnpegelldkllkllllllkeelfevdfvplt---------------------------
00494741   1/1  pGGrlvlsdplrp.geevllelldalfilkllfkglrel-------------------------------
00473861   1/1  vlsepnlpdleellelllelllellpllglllleierllellephlrfltleelrel-------------
00501541   1/1  pnrpdllsleeleelleragftgvrllslee..........................gfelvllkk..kk
00474711   1/1  plhhlpdpellqreflreaarlLkpG--------------------------------------------
00495321   1/1  sNPPysgsgvlhhlpdevrlepplalaggedgllvlealleeaarlLkpGGrlvlvtpsgel........
00509351   1/1  lekllkeaarlLkpgGrlvlsdg..ssyleeleelekalkllgfklleviklilplldaerh--------
00415801   1/1  leflpfpdgkfDlivsNPPygglsellievlhhlpdlaldggkdgleal---------------------
00502421   1/1  nrpsleelllllllllllllphgrflsleeleelleeaGfevveveelplgpllllrllklll..dllll
00421971   1/1  kPGGrlilstpnppylee.lrellekllrllepllalvygfdglkvlrl---------------------
00507451   1/1  lalala.rpgakvtgvDispealelar-------------------------------------------
00518231   1/1  arenaalngldnrvefivgDaedllkellkp---------------------------------------
00451091   1/1  lLkpgGrlvlvvgtl......edveillkvppgaffpp.....pkvdsavvrltrrespllleiltlelr
00430851   1/1  snavlhhl........leellrlLkpGGrlvlsvpnr---------------------------------
00445501   1/1  a---------------------------------------------------------------------
00475801   1/1  LkpGGrlvlvvgtlegleellellk---------------------------------------------
00467441   1/1  .dpealleeaarlLkpGGrlvlstpsrteeeleellegf..............eellell----------
00415931   1/1  khvyGieiseealelakenake------------------------------------------------
00509191   1/1  GGvlvistll.gwdeeledll......evvrlvseeelealleeaGfelveverpl--------------
00519301   1/1  lelarenaklngleddnvefi-------------------------------------------------
00479231   1/1  pnpegleellellkklgflvelillyifpyvpl-------------------------------------
00484381   1/1  rlvlstpsreeeellellllleellelleegfelveivellple--------------------------
00472111   1/1  fDavvssfvlhhvppdlpdleralrelarlLrPGGrlllvepl.rls.....dyivgdgrfvgr------
00474651   1/1  ----------------------------------------------------------------------
00526181   1/1  lGvDispealelArenlklngld..---------------------------------------------
00521821   1/1  Gvlvldnvllpgavddpealrellellr------------------------------------------
00379821   1/1  rvLkpGGrlvisdfsrsidspeeneevf..eellklgfegfk----------------------------
00526491   1/1  elarvLkpGGrlvlstpnrdyleellellkalgfllllifpgldl-------------------------
00514491   1/1  vLkpGGrlvlstpnldyleellellkalgflvlliepglllpilkfls----------------------
00516571   1/1  vlstlllaglelerdaeh.......vrfvtpeelealleeaGfevve-----------------------
00409641   1/1  edekfDviiaDlpdsiglphl..ldleeflrelyrvLkpgGvlvvnslspdellellkell---------
00516171   1/1  vaerlvapp-------------------------------------------------------------
00366101   1/1  prt.....................laeellelleeagfeveevkdldgfprtvhve--------------
00476761   1/1  ----------------------------------------------------------------------
00390931   1/1  ----------------------------------------------------------------------
00408291   1/1  alrvLkpgGrlvlvtfss.ledeivkkllkelgklvlvvkgpllp-------------------------
00403271   1/1  yraLkpgGrliivepvlpdlgelpltellallldllmlvltdggrertleelrelle-------------
00413261   1/1  elleeaarlLkpgGrlvlstplptq.....................leellel-----------------
00531071   1/1  vsnppyglegledlekllkea.rlLk--------------------------------------------
00465681   1/1  lleealrlLkpgGrlvlstcs.ee----------------------------------------------
00488051   1/1  gDaeellklpfpdgsfDvvlsdavlh....pdpeaaleealrvLkpGGrlvisdftreqdsple------
00426821   1/1  lrlLkpgGrlvilv......qnltlvelllkvpkeafvPpPkvdsavvrlepkgipllpkdeellerlvk
00350261   1/1  sfDl------------------------------------------------------------------
00520841   1/1  dgsfDlvydrg-----------------------------------------------------------
00494421   1/1  ----------------------------------------------------------------------
00518401   1/1  ----------------------------------------------------------------------
00519441   1/1  ----------------------------------------------------------------------
00505191   1/1  ----------------------------------------------------------------------
00507491   1/1  leelleaaarlLkpgGrlvlvi------------------------------------------------
00478621   1/1  gdllkliledgkfDvvlsdpplehi........leeiarlLkPGGklvlvtpdin......---------
00528941   1/1  edprkllrelarvLkpgGrlvlvtpnlespepsnvlddlllslflslgesflldiekldddirfllsvde
00487741   1/1  alppedrerylr----------------------------------------------------------
00532291   1/1  ----------------------------------------------------------------------
00531101   1/1  alrllkpgGvlvlcnp------------------------------------------------------
00490691   1/1  lmfqk-----------------------------------------------------------------
00527491   1/1  ----------------------------------------------------------------------
00473031   1/1  .vsn------------------------------------------------------------------
00529821   1/1  efleeaarlLkpGGylaviepviq.dlfdlldrlllvitsvsrldsladivk------------------
00520011   1/1  d---------------------------------------------------------------------
00530871   1/1  ----------------------------------------------------------------------
00506931   1/1  ----------------------------------------------------------------------
00485241   1/1  ----------------------------------------------------------------------
00491861   1/1  l.pevlalkrallaeagalpgllglllldlsllslllssdrvrfvaaDlrdldwl---------------
00527391   1/1  ----------------------------------------------------------------------
00369761   1/1  ----------------------------------------------------------------------
00405511   1/1  aggllpldlarlllkgvnlrgsflgtraalpell------------------------------------
00367461   1/1  ggvivdvgladgel--------------------------------------------------------
00525101   1/1  l---------------------------------------------------------------------
00526931   1/1  ggllvvesnsdlllpdllkglvllkarky-----------------------------------------
00432761   1/1  lpgplplpladlllkgvtiig-------------------------------------------------
00379521   1/1  ----------------------------------------------------------------------
00423661   1/1  dvaidqgeltlplttlvlkgvtvvgsvvl.van-------------------------------------
00383791   1/1  gipvvsgagag.gqldpteillkglsvrglfvlp------------------------------------
00513271   1/1  vlgggnllelplpllllllkgltlvgsllgtrael-----------------------------------


                         -         -         -         -         *         -         -:420
query           YDERFFRMWEFYLAGSEMAFTHENFHIFQIQLAKDRDAVPHNRDYIAQNEAKLLEFEKTRPPLEKVSF--
00401961   1/1  erleanldellalldeeflrrlreylaafaaafr------------------------------------
00527091   1/1  erllanrdellalldeeflrmwrlyllacaagfr------------------------------------
00478511   1/1  aktleawldrllanldellkllderfyrlwelyl------------------------------------
00496711   1/1  lerflgrldellalldeeflrlwrlyllacalgf------------------------------------
00479191   1/1  erllgalgellalldeeflrlwrlylllcalgfr------------------------------------
00479451   1/1  yaktlnawlerflanl------------------------------------------------------
00414441   1/1  lelleelvleyleeflrlwrlyla........gla-----------------------------------
00497781   1/1  ----------------------------------------------------------------------
00466961   1/1  i...vdedlartwefylavlrdgflhgllgwfdvv-----------------------------------
00518841   1/1  fgeiev........................velllrewevrfeia-------------------------
00507621   1/1  ----------------------------------------------------------------------
00491711   1/1  fevvevedltedy---------------------------------------------------------
00512611   1/1  plprrlgh..dgffl-------------------------------------------------------
00525361   1/1  ----------------------------------------------------------------------
00469311   1/1  lefdllkll..ldelgfr.vefylaacedgflhgl-----------------------------------
00528071   1/1  leil...ledlgrtwefylaaleagflhgligwfq-----------------------------------
00490741   1/1  ----------------------------------------------------------------------
00476561   1/1  lecfiegsiegellldfltvvkdfrktaseel--------------------------------------
00450601   1/1  ----------------------------------------------------------------------
00511031   1/1  ----------------------------------------------------------------------
00518851   1/1  pelleeilellkel.fpgvelprlpv--------------------------------------------
00502341   1/1  eilklllkellerllelllllleggflekll---------------------------------------
00491221   1/1  ----------------------------------------------------------------------
00484901   1/1  ----------------------------------------------------------------------
00509881   1/1  ----------------------------------------------------------------------
00497191   1/1  ----------------------------------------------------------------------
00473291   1/1  ----------------------------------------------------------------------
00498851   1/1  ----------------------------------------------------------------------
00518421   1/1  llllr......ellaallellrr-----------------------------------------------
00530771   1/1  ----------------------------------------------------------------------
00463541   1/1  ----------------------------------------------------------------------
00468401   1/1  ----------------------------------------------------------------------
00512391   1/1  ----------------------------------------------------------------------
00468381   1/1  ----------------------------------------------------------------------
00511431   1/1  glgvnlld.gllallelllelllllllllalkkgllklgllkk---------------------------
00499151   1/1  dsgnvfllaskgppvpf-----------------------------------------------------
00486291   1/1  dlplryeftleawrd......-------------------------------------------------
00516791   1/1  ----------------------------------------------------------------------
00446891   1/1  ----------------------------------------------------------------------
00494741   1/1  ----------------------------------------------------------------------
00473861   1/1  ----------------------------------------------------------------------
00501541   1/1  lilkidlkfirliel-------------------------------------------------------
00474711   1/1  ----------------------------------------------------------------------
00495321   1/1  .---------------------------------------------------------------------
00509351   1/1  ----------------------------------------------------------------------
00415801   1/1  ----------------------------------------------------------------------
00502421   1/1  lallllla--------------------------------------------------------------
00421971   1/1  ----------------------------------------------------------------------
00507451   1/1  ----------------------------------------------------------------------
00518231   1/1  ----------------------------------------------------------------------
00451091   1/1  fvffvldeelllrlvkeafsqrr-----------------------------------------------
00430851   1/1  ----------------------------------------------------------------------
00445501   1/1  ----------------------------------------------------------------------
00475801   1/1  ----------------------------------------------------------------------
00467441   1/1  ----------------------------------------------------------------------
00415931   1/1  ----------------------------------------------------------------------
00509191   1/1  ----------------------------------------------------------------------
00519301   1/1  ----------------------------------------------------------------------
00479231   1/1  ----------------------------------------------------------------------
00484381   1/1  ----------------------------------------------------------------------
00472111   1/1  ----------------------------------------------------------------------
00474651   1/1  ----------------------------------------------------------------------
00526181   1/1  ----------------------------------------------------------------------
00521821   1/1  ----------------------------------------------------------------------
00379821   1/1  ----------------------------------------------------------------------
00526491   1/1  ----------------------------------------------------------------------
00514491   1/1  ----------------------------------------------------------------------
00516571   1/1  ----------------------------------------------------------------------
00409641   1/1  ----------------------------------------------------------------------
00516171   1/1  ----------------------------------------------------------------------
00366101   1/1  ----------------------------------------------------------------------
00476761   1/1  ----------------------------------------------------------------------
00390931   1/1  ----------------------------------------------------------------------
00408291   1/1  ----------------------------------------------------------------------
00403271   1/1  ----------------------------------------------------------------------
00413261   1/1  ----------------------------------------------------------------------
00531071   1/1  ----------------------------------------------------------------------
00465681   1/1  ----------------------------------------------------------------------
00488051   1/1  ----------------------------------------------------------------------
00426821   1/1  aafsqrrktlrnalkll-----------------------------------------------------
00350261   1/1  ----------------------------------------------------------------------
00520841   1/1  ----------------------------------------------------------------------
00494421   1/1  ----------------------------------------------------------------------
00518401   1/1  ----------------------------------------------------------------------
00519441   1/1  ----------------------------------------------------------------------
00505191   1/1  ----------------------------------------------------------------------
00507491   1/1  ----------------------------------------------------------------------
00478621   1/1  ----------------------------------------------------------------------
00528941   1/1  lkr-------------------------------------------------------------------
00487741   1/1  ----------------------------------------------------------------------
00532291   1/1  ----------------------------------------------------------------------
00531101   1/1  ----------------------------------------------------------------------
00490691   1/1  ----------------------------------------------------------------------
00527491   1/1  ----------------------------------------------------------------------
00473031   1/1  ----------------------------------------------------------------------
00529821   1/1  ----------------------------------------------------------------------
00520011   1/1  ----------------------------------------------------------------------
00530871   1/1  ----------------------------------------------------------------------
00506931   1/1  ----------------------------------------------------------------------
00485241   1/1  ----------------------------------------------------------------------
00491861   1/1  ----------------------------------------------------------------------
00527391   1/1  ----------------------------------------------------------------------
00369761   1/1  ----------------------------------------------------------------------
00405511   1/1  ----------------------------------------------------------------------
00367461   1/1  ----------------------------------------------------------------------
00525101   1/1  ----------------------------------------------------------------------
00526931   1/1  ----------------------------------------------------------------------
00432761   1/1  ----------------------------------------------------------------------
00379521   1/1  ----------------------------------------------------------------------
00423661   1/1  ----------------------------------------------------------------------
00383791   1/1  ----------------------------------------------------------------------
00513271   1/1  ----------------------------------------------------------------------