[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for atum0:AAK86566.1


[Show Plain Result]

## Summary of Sequence Search
   1::272
   9::261  4.6e-68 32.7% 0049902 00499021 1/1   )-binding Rossmann-fold domains         
   4::257  9.5e-63 32.5% 0046592 00465921 1/1   )-binding Rossmann-fold domains         
  10::262    1e-62 31.5% 0048361 00483611 1/1   )-binding Rossmann-fold domains         
   6::259  1.9e-59 30.7% 0053266 00532661 1/1   )-binding Rossmann-fold domains         
   8::258  2.7e-59 30.7% 0049943 00499431 1/1   )-binding Rossmann-fold domains         
   6::261  4.1e-58 32.0% 0048949 00489491 1/1   )-binding Rossmann-fold domains         
   5::259  9.3e-57 33.1% 0052988 00529881 1/1   )-binding Rossmann-fold domains         
   5::256  9.4e-55 30.5% 0045076 00450761 1/1   )-binding Rossmann-fold domains         
   9::259  9.1e-54 30.5% 0042131 00421311 1/1   )-binding Rossmann-fold domains         
   8::253  1.5e-52 31.1% 0051568 00515681 1/1   )-binding Rossmann-fold domains         
   4::265  3.3e-52 31.2% 0038042 00380421 1/1   )-binding Rossmann-fold domains         
   5::259  5.1e-52 30.4% 0037662 00376621 1/1   )-binding Rossmann-fold domains         
   7::257  7.1e-52 29.8% 0050365 00503651 1/1   )-binding Rossmann-fold domains         
   5::255    1e-51 31.4% 0039438 00394381 1/1   )-binding Rossmann-fold domains         
   7::257  3.4e-50 30.5% 0051006 00510061 1/1   )-binding Rossmann-fold domains         
   5::260  4.1e-50 31.2% 0035018 00350181 1/1   )-binding Rossmann-fold domains         
   6::257  5.6e-50 30.0% 0043703 00437031 1/1   )-binding Rossmann-fold domains         
   8::270  1.3e-49 29.0% 0050967 00509671 1/1   )-binding Rossmann-fold domains         
   7::257  2.9e-49 30.6% 0050776 00507761 1/1   )-binding Rossmann-fold domains         
   8::264  2.9e-49 30.0% 0053286 00532861 1/1   )-binding Rossmann-fold domains         
   8::259  3.6e-49 32.0% 0052529 00525291 1/1   )-binding Rossmann-fold domains         
   2::257    4e-49 31.4% 0047124 00471241 1/1   )-binding Rossmann-fold domains         
   6::260  4.4e-49 31.4% 0052368 00523681 1/1   )-binding Rossmann-fold domains         
   3::260    5e-49 31.7% 0045153 00451531 1/1   )-binding Rossmann-fold domains         
  10::260  3.9e-48 31.4% 0046483 00464831 1/1   )-binding Rossmann-fold domains         
   4::257  4.7e-48 32.0% 0042429 00424291 1/1   )-binding Rossmann-fold domains         
  11::255  1.3e-47 29.8% 0042505 00425051 1/1   )-binding Rossmann-fold domains         
  10::257  1.9e-47 31.8% 0038068 00380681 1/1   )-binding Rossmann-fold domains         
  10::256  3.2e-47 33.3% 0036922 00369221 1/1   )-binding Rossmann-fold domains         
   5::259  3.6e-47 31.3% 0038770 00387701 1/1   )-binding Rossmann-fold domains         
   8::257  3.6e-47 32.9% 0036194 00361941 1/1   )-binding Rossmann-fold domains         
   5::255  4.6e-47 32.6% 0051279 00512791 1/1   )-binding Rossmann-fold domains         
   8::256  4.6e-47 32.8% 0051965 00519651 1/1   )-binding Rossmann-fold domains         
   5::257  1.4e-46 32.1% 0041610 00416101 1/1   )-binding Rossmann-fold domains         
   8::257  1.6e-46 32.4% 0050237 00502371 1/1   )-binding Rossmann-fold domains         
   6::257  4.7e-46 32.9% 0039871 00398711 1/1   )-binding Rossmann-fold domains         
   8::258  4.8e-46 30.1% 0047470 00474701 1/1   )-binding Rossmann-fold domains         
   8::257  5.4e-46 30.7% 0050383 00503831 1/1   )-binding Rossmann-fold domains         
   5::261  6.6e-46 31.1% 0041366 00413661 1/1   )-binding Rossmann-fold domains         
   8::256  7.1e-46 32.3% 0051763 00517631 1/1   )-binding Rossmann-fold domains         
   6::257  7.2e-46 32.1% 0051702 00517021 1/1   )-binding Rossmann-fold domains         
   6::257    1e-45 30.6% 0051440 00514401 1/1   )-binding Rossmann-fold domains         
   6::256  1.2e-45 33.3% 0038545 00385451 1/1   )-binding Rossmann-fold domains         
   1::256    4e-45 31.5% 0052085 00520851 1/1   )-binding Rossmann-fold domains         
   1::254  4.4e-45 31.3% 0050955 00509551 1/1   )-binding Rossmann-fold domains         
   6::258  4.8e-45 32.1% 0049942 00499421 1/1   )-binding Rossmann-fold domains         
   7::258  9.5e-45 33.2% 0036806 00368061 1/1   )-binding Rossmann-fold domains         
   6::254  1.5e-44 32.4% 0038814 00388141 1/1   )-binding Rossmann-fold domains         
   7::259    2e-44 31.5% 0041692 00416921 1/1   )-binding Rossmann-fold domains         
  10::263  3.2e-44 29.8% 0046801 00468011 1/1   )-binding Rossmann-fold domains         
   8::255    1e-43 32.0% 0051093 00510931 1/1   )-binding Rossmann-fold domains         
  10::259  1.4e-43 30.3% 0048243 00482431 1/1   )-binding Rossmann-fold domains         
   8::259  1.9e-43 30.1% 0052873 00528731 1/1   )-binding Rossmann-fold domains         
   9::255  2.2e-43 32.2% 0047681 00476811 1/1   )-binding Rossmann-fold domains         
   4::256  4.8e-43 30.6% 0050022 00500221 1/1   )-binding Rossmann-fold domains         
   8::257  6.8e-42 35.1% 0051355 00513551 1/1   )-binding Rossmann-fold domains         
   8::257    7e-42 30.8% 0048286 00482861 1/1   )-binding Rossmann-fold domains         
  11::260    1e-41 31.9% 0051955 00519551 1/1   )-binding Rossmann-fold domains         
   9::259  1.4e-41 31.7% 0050655 00506551 1/1   )-binding Rossmann-fold domains         
   8::256  2.2e-41 31.7% 0035471 00354711 1/1   )-binding Rossmann-fold domains         
   6::250  4.3e-41 33.3% 0043678 00436781 1/1   )-binding Rossmann-fold domains         
   4::256  1.4e-40 29.1% 0038342 00383421 1/1   )-binding Rossmann-fold domains         
   8::265  7.4e-40 28.6% 0051260 00512601 1/1   )-binding Rossmann-fold domains         
   5::270  2.3e-39 26.8% 0051203 00512031 1/1   )-binding Rossmann-fold domains         
   6::253  4.2e-37 30.3% 0051109 00511091 1/1   )-binding Rossmann-fold domains         
   2::259  4.6e-37 32.9% 0052744 00527441 1/1   )-binding Rossmann-fold domains         
   8::253  7.8e-37 29.6% 0051511 00515111 1/1   )-binding Rossmann-fold domains         
   4::256  1.7e-36 30.8% 0051542 00515421 1/1   )-binding Rossmann-fold domains         
  10::259  2.3e-36 31.3% 0049845 00498451 1/1   )-binding Rossmann-fold domains         
   9::262  4.8e-36 30.6% 0048614 00486141 1/1   )-binding Rossmann-fold domains         
   5::261  2.3e-35 30.4% 0040910 00409101 1/1   )-binding Rossmann-fold domains         
   6::268  3.9e-35 30.5% 0035305 00353051 1/1   )-binding Rossmann-fold domains         
   5::252  4.3e-35 29.8% 0041757 00417571 1/1   )-binding Rossmann-fold domains         
   9::264  1.1e-33 31.0% 0038559 00385591 1/1   )-binding Rossmann-fold domains         
   8::195  4.8e-21 29.4% 0048035 00480351 1/1   )-binding Rossmann-fold domains         
   5::255  7.5e-21 26.4% 0050721 00507211 1/1   )-binding Rossmann-fold domains         
  11::253  8.5e-20 26.2% 0049864 00498641 1/1   )-binding Rossmann-fold domains         
   8::256  1.2e-18 30.0% 0049357 00493571 1/1   )-binding Rossmann-fold domains         
  10::256  2.4e-18 26.6% 0046034 00460341 1/1   )-binding Rossmann-fold domains         
  11::256  1.2e-17 26.8% 0048293 00482931 1/1   )-binding Rossmann-fold domains         
  11::257  1.5e-17 24.2% 0049026 00490261 1/1   )-binding Rossmann-fold domains         
   8::253  1.9e-17 24.8% 0046574 00465741 1/1   )-binding Rossmann-fold domains         
  11::272    5e-17 25.8% 0049519 00495191 1/1   )-binding Rossmann-fold domains         
   8::253  8.1e-17 26.0% 0043041 00430411 1/1   )-binding Rossmann-fold domains         
  11::256  1.9e-16 25.0% 0046897 00468971 1/1   )-binding Rossmann-fold domains         
   5::165  2.1e-16 24.0% 0047965 00479651 1/1   )-binding Rossmann-fold domains         
  12::262  8.5e-16 22.6% 0037128 00371281 1/1   )-binding Rossmann-fold domains         
   8::253  3.2e-15 23.9% 0053287 00532871 1/1   )-binding Rossmann-fold domains         
  11::197    6e-15 28.3% 0051491 00514911 1/1   )-binding Rossmann-fold domains         
   8::253  2.6e-14 23.1% 0051183 00511831 1/1   )-binding Rossmann-fold domains         
  11::256  4.5e-14 26.4% 0049117 00491171 1/1   )-binding Rossmann-fold domains         
  10::199  1.2e-13 30.4% 0036785 00367851 1/1   )-binding Rossmann-fold domains         
   8::253  3.4e-13 21.9% 0040043 00400431 1/1   )-binding Rossmann-fold domains         
  11::253  3.1e-12 23.6% 0043337 00433371 1/1   )-binding Rossmann-fold domains         
   8::254  3.7e-12 23.7% 0046472 00464721 1/1   )-binding Rossmann-fold domains         
   9::197  4.8e-12 23.4% 0049428 00494281 1/1   )-binding Rossmann-fold domains         
   8::253  5.4e-12 21.2% 0038324 00383241 1/1   )-binding Rossmann-fold domains         
   8::160  1.7e-11 22.1% 0046529 00465291 1/1   )-binding Rossmann-fold domains         
  11::253  9.6e-11 23.4% 0041999 00419991 1/1   )-binding Rossmann-fold domains         
   8::253  1.2e-10 21.7% 0051991 00519911 1/1   )-binding Rossmann-fold domains         
   8::253  1.5e-10 19.8% 0052722 00527221 1/1   )-binding Rossmann-fold domains         
   3::189  4.9e-10 26.1% 0048516 00485161 1/1   )-binding Rossmann-fold domains         
   8::181  6.4e-10 27.6% 0042180 00421801 1/1   )-binding Rossmann-fold domains         
   8::252  3.3e-09 23.2% 0043042 00430421 1/1   )-binding Rossmann-fold domains         
   3::179  4.4e-09 26.2% 0048414 00484141 1/1   )-binding Rossmann-fold domains         
  11::272  7.4e-09 20.6% 0046291 00462911 1/1   )-binding Rossmann-fold domains         
  11::195  2.3e-06 22.5% 0051925 00519251 1/1   )-binding Rossmann-fold domains         
  11::170  1.3e-05 22.5% 0038784 00387841 1/1   )-binding Rossmann-fold domains         
   7::170  4.1e-05 21.7% 0035477 00354771 1/1   )-binding Rossmann-fold domains         
  21::171  5.8e-05 16.5% 0049686 00496861 1/1   )-binding Rossmann-fold domains         
   8::160  0.00014 18.9% 0034872 00348721 1/1   )-binding Rossmann-fold domains         
  11::192   0.0003 24.6% 0048186 00481861 1/1   )-binding Rossmann-fold domains         
   1::272


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAQASGLMAGKRGLIMGVANNRSIAWGIAKACADAGAELALTWQGDALKKRVEPLAQELGAFMAGHCDVT
00499021   1/1  --------kgkvalvtGasnesgIGraiAlalaeeGakVvltdrneealeelaaelealldeslllslel
00465921   1/1  ---mlldlkgkvalvtGaanssgiGraiAralaaeGarVvltdrneealeelaaeleaalpsslllelee
00483611   1/1  ---------GkvalvtGasnesgiGraiAlalaeeGakVvitdrneealeelaaeleallseelllelee
00532661   1/1  -----gslkgkvalvtGAaGssgiGlaiAralaeeGakVvltdrneekleelaellalggkvlavalDvt
00499431   1/1  -------lmlldlkgkvalvtGAagssgiGlaiAralaeeGakVvltdrneekleelaeeleelgkvlav
00489491   1/1  -----gllkgkvalvtGAagssgiGlaiAralaeeGakVvltdrnekleelaeeleaaggkvlavalDvt
00529881   1/1  ----llslkgkvalvtGasselgiGlaiAralaaeGarVvltdrne...ealeelaaeleggralavalD
00450761   1/1  ----llvlllllllllslkgkvalvTGas..sgiGraiaralaaaGarVvlldrsseekleelaaeleal
00421311   1/1  --------kgkvalvTGas..sgiGraiAralaaeGarVvltdrnseekleelaaeleallggralaval
00515681   1/1  -------mdlkgkvalvTGas..sgiGlaiAralaaaGarVvltdrneekleelaaelealggrvlaval
00380421   1/1  ---mmlslkgkvalvTGas..sGiGlaiaralaaaGarVvlldrne...ekleelaaeleallggrvlav
00376621   1/1  ----llllmllslkgkvalvTGas..sgiGraiAralaaaGarVvltdrneekleelaaelealggrvla
00503651   1/1  ------slkgkvalvtGas..sgiGlaiAralaeeGakVvltdrneekleelaaelealggkvlavalDv
00394381   1/1  ----mmslkgkvalvTGas..sgiGraiaralaaaGarVvltdrsgeekleelaaelealggrvlavalD
00510061   1/1  ------mslkgkvalvTGas..sgiGlaiAralaaeGarVvltdrneekleelaaelealglpsgrvlav
00350181   1/1  ----mmdlkgkvalvTGas..sgiGlaiaralaaaGarVvlldrne...ekleelaaelralggrvlava
00437031   1/1  -----mdlkgkvalvtGas..sGiGraiAralaaeGarVvltdrneekleelaaelrallplggrvlava
00509671   1/1  -------dlkgkvalvTGas..sgiGlaiAralaaeGarVvltdrneekleelaaelealglpsgrvlav
00507761   1/1  ------mlkgkvalvTGas..sgiGlaiAralaaeGarVvltdlrneekleelaaellealggrvlaval
00532861   1/1  -------sdmldlkgkvalvtGas..sgiGlaiAralaeeGakVvltdrneekleelaaelealggkvla
00525291   1/1  -------gdlsgkvalvtGas..sgiGlaiAralaaeGarVvltdrne.leelaaelealggrvlavalD
00471241   1/1  -llmllslkgkvalvTGas..sGiGlaiAralaaaGarVvltdrse...ekleelaaeleallggrvlav
00523681   1/1  -----dllkgkvalvtGas..sgiGlaiaralaeeGakVvltdrneeleelaeel.....kvlavalDvt
00451531   1/1  --psllslkgkvalvTGas..sgiGlaiAralaaaGarVvltdrne...ekleelaaelealggrvlava
00464831   1/1  ---------sgkvalvTGas..sGiGlaiAralaaeGakVvlltdrneekleelaeeleallggkvlava
00424291   1/1  ---mmlslkgkvvlvtGas..ggiGralaralaaaGarVvlldrse...ekleelaaelgrvlavvlDvt
00425051   1/1  ----------kvalvTGas..sgiGraiAlalaaeGarVvltdrneealeela.....ggkalavalDvt
00380681   1/1  ---------gkvalvTGas..ggiGlaiaralaaeGarVvlldr...neekleelaaelealggrvlava
00369221   1/1  ---------gkvalvTGas..sgiGlaiAralaaaGarVvlldrsg..aekleelaaelealggrvlava
00387701   1/1  ----mmdlkgkvalvTGas..ggiGlaiaralaaeGarVvlldr...neekleelaaelggrvlavalDv
00361941   1/1  -------mdlkgkvalvtGas..ggiGraiaralaaaGarVvlldrne...ekleelaaelgrvlavvlD
00512791   1/1  ----lldlkgkvalvTGas..sgiGlaiAralaaaGarVvlldrne...ekleelaaelgrvlavalDvt
00519651   1/1  -------smdlkgkvalvTGas..sgiGlaiAralaaaGarVvltdrneekleelaaelea.ggrvlavq
00416101   1/1  ----mmslkgkvalvTGas..sgiGlaiAralaaeGarVvltdrne...ekleelaaeleaggrvlaval
00502371   1/1  -------mdlkgkvalvtGas..sgiGlaiAralaaaGarVvltdrnaekleelaaellealggrvlava
00398711   1/1  -----mdlkgkvalvTGas..sgiGraiaralaaaGarVvlldr...neekleelaaelggrvlavalDv
00474701   1/1  -------dlkgkvalvtGas..sgiGlaiAralaaeGarVvltdrneekleelaaelealggkarvlava
00503831   1/1  -------lllllllllllllldlllslldlkgkvalvTGas..gGiGraiAralaaaGarVvlldrneek
00413661   1/1  ----mmdlkgkvalvtGas..sgiGlaiaralaaeGarVvlldrne...ekleelaaelggrvlavalDv
00517631   1/1  -------mldlkgkvalvtGas..sgiGlaiaralaaaGarVvlldrne...ekleelaae.grvlaval
00517021   1/1  -----ldlkgkvalvtGas..sgiGlaiAralaaaGarVvlldrse...ekleelaaelggrvlavalDv
00514401   1/1  -----gsslldmldlkgkvalvTGas..ggiGraiAralaaaGarVvlldrneekleelaaeleaelpll
00385451   1/1  -----ldlkgkvalvTGas..ggiGlaiAralaaaGarVvlldr...seekleelaaelggrvlavalDv
00520851   1/1  llsllsllkgkvalvtGas..sgiGlaiAralaaaGarVvltdrsaekleelaaelealggrvlavalDv
00509551   1/1  lllmlldlkgkvalvTGas..sgiGlaiAralaaaGarVvlldrne...ekleelaaeleallpggrvla
00499421   1/1  -----ldlkgkvalvtGas..sgiGlaiaralaaaGarVvlldrse...ekleelaael.rvlavalDvt
00368061   1/1  ------dlkgkvalvTGas..sgiGlaiAralaaaGarVvlldr...neekleelaaelggrvlavalDv
00388141   1/1  -----ldlkgkvalvTGas..sgiGraiaralaarGarVvlldrse...ekleelaaelggrvlavalDv
00416921   1/1  ------dlkgkvalvtGas..sgiGraiaralaaeGarVvltarneekle........ggralavvlDvt
00468011   1/1  ---------gkvalvTGas..sgiGraiaralaaaGarVvlldrneek................vqlDvt
00510931   1/1  -------llllmlldlkgkvalvTGas..sGiGraiAralaaaGarVvltarneekleelaaelralggd
00482431   1/1  ---------lpvalvTGas..sGiGlaiAralaaaGarVvltdrlneekleelaaelralpggrvlaval
00528731   1/1  -------lkgkvalvTGas..sgiGlaiaralaaeGarVvlldrneekleelaaeleallpggrvlaval
00476811   1/1  --------kgkvalvTGas..sGiGlaiAralaaaGarlllVvltdr...neekleelaaelrallpsgg
00500221   1/1  ---lllslkgkvalvTGas..sgiGlaiAralaaeGarVvlldrseeale..........rvlavalDvt
00513551   1/1  -------lkgkvalvTGas..ggiGlaiaralaeeGdlakVvlldr...neekleelaaelggrvlfvql
00482861   1/1  -------mlkgkvvlvTGassG..iGlalaralaarGasrVvlldr...neekleelaaelealggrvlf
00519551   1/1  ----------kkvalvtGas..sgiGlaiAralaeeGarlllleeeVvltdrneekleelaaelealggk
00506551   1/1  --------sGmkvalvTGas..sgiGlaiaralaealGakVvltdr...neekleelaaelealggrvlf
00354711   1/1  -------MslkgkvvlvTGas..ggiGralaralaaaGarVvlldr...seekleelaaelggrvlaval
00436781   1/1  -----mdlkgkvalvTGas..sgiGlaiAralaaaGarVvlldr...seekleelaaelggrvlavalDv
00383421   1/1  ---pslslkgkvalvTGas..gGiGralaralaarGarVvlldrsglssllllsaekleelaaelggrvl
00512601   1/1  -------sdmslkgkvalvTGas..ggiGlalAralaarGarVvlldrseekleelaaelealggrvlvv
00512031   1/1  ----dslsllslkgkvalvTGas..sGiGraiAralaeeGarVvltdrneekleelaaelealgggkvla
00511091   1/1  -----sslsllldmlslkgkvalvTGas..ggiGralaralaarGarVvlldrseekleelaaelealgg
00527441   1/1  -amdlgllsgkvvlvTGas..ggiGralaralaarGarvVvlldrsglleekleelaaelealggrvlfv
00515111   1/1  -------LkgkvalvTGAs..sGiGraiAralaalleegarVvlvarneekleelaaeleallpggrvla
00515421   1/1  ---mmldlkgkvalvTGas..sGiGraiAralaarGarVvladrseelaeleagleklealaeelggrvl
00498451   1/1  ---------gkvalvTGas..sgiGralaralaarGarVvlldrsee...........ggrvlavaaDvt
00486141   1/1  --------kgkvvlvtGgs..ggiGsalaralaaeGakvvlvdr......seealae.gggalavaaDvt
00409101   1/1  ----mmdlkgkvalvTGas..sgIGlaiaralaaeGarvvlldr...neekleelaaelealpggrvlav
00353051   1/1  -----mdlkgkvalvTGas..sGIGlaiAralaarGarvvlldr...neekleelaaelralpggrvlav
00417571   1/1  ----mmdlkgkvalvTGAs..sGiGraiAralaalleeGarvvltarneekleelaaeleallpggrvla
00385591   1/1  --------egkvvLVtGgsg..giGraiaralaaaGarVvvvdrseeal.........gggvlavaaDvt
00480351   1/1  -------gllldtallvllllllllldlkgkvalVtGasg..giGlaiAralaaaGarVvladrneekle
00507211   1/1  ----ldmmslmgktvlvTGat..GgiGsalaraLlarGaeVvlldrspekleelaaelealggvefvqgD
00498641   1/1  ----------krvLvTGgt..GfiGsalaraLlerGaevvvldr...seekleelleeleallggrvefv
00493571   1/1  -------llsllsslldllslkgktvlvTGat..GgiGsalaraLlarGaeVvlldr...spekleelaa
00460341   1/1  ---------gktvlvTGat..GgiGsalaraLlarpGaeVvaldrltsagsp...eklealaael.gvef
00482931   1/1  ----------nktvlvTGat..GgiGsalaraLlarGaeVvlldrlssgaseekleelaaelraaggpgv
00490261   1/1  ----------ktvlvTGat..GgiGsalaraLlarGaeVvaldrspeklealaaeleallpllllfellg
00465741   1/1  -------M.gktvlvTGat..GgiGsalaraLlarGaeVvlldrspsslllllekleelaaelealgggv
00495191   1/1  ----------rktvlvTGat..GgiGsalaraLlarGaeVvlldrlssglspekleellaellealgggv
00430411   1/1  -------MsgkkvlvtGAt..GfiGshlaraLleaGhevvalvRspekaalalalelleelaapgvevve
00468971   1/1  ----------ktvlvTGat..GgiGsalaraLlarpGaeVvaldrlsspeklealaallgal.gvefvqg
00479651   1/1  ----GkplvlggslgrseatgygvvysllaalkrllmglslegkvvlVtGaG...giGraiarrlaaeGa
00371281   1/1  -----------kvlVTGgaG..fiGsalvraLlerGyeevvvldrlesgakl.......gpgvefvegDl
00532871   1/1  -------lsgktvlVtGAt..GgiGsalvrrLleagdvaevvalvr......spekleelgggvevvvgD
00514911   1/1  ----------SKtvlvTGat..GgiGsalaraLlerGaeVvlldr...spekleellaeleallgggvef
00511831   1/1  -------llllmmmslegktvLVTGAt..GfiGsalvrrLlerGyeVvaldr...spekleelaalleal
00491171   1/1  ----------ktvlvTGat..GgiGsalaraLlallllslaGaevvaldrsp.seealealaellalggv
00367851   1/1  ---------kgkkvlviGa...GgiGralaraLaeaGaevt...vadrslekaealaaelggveavelDv
00400431   1/1  -------M.gkkvLvTGg..tGfiGsalvraLlerGaevvvldrdpegaaellallealggprvefvagD
00433371   1/1  ----------ktvLVTGat..GfiGsalaraLlerGyrVvaldr...dpekleellaelealgggvefve
00464721   1/1  -------M.gktvlvtGat..GfiGsalaraLlarGaveVvaldrspe....................Dl
00494281   1/1  --------emktvlitGA..nRGiGlelvkqllelakrgllviataRdpekaeeleelaaegsnlvilql
00383241   1/1  -------M.gkrvLvTGgt..GfiGshlvraLlerpGhevvvldrlpsgadallellalltlllsllekl
00465291   1/1  -------PctplgvllllellgillllllmmlrlkgkvalVtGass..giGralAllLareGatVvvvdr
00419991   1/1  ----------kkvLvTGgt..GfiGshlaraLlerGaevvvldrls...egaeellaelealgprvefvk
00519911   1/1  -------lllllllimmmlkgkkvlvtGAt..GgiGralvkeLlergavskVtalvRrp...ekleelaa
00527221   1/1  -------llllkillslkgkkvlvtGA..tGgiGralvkellargavskvialvRrp...ekleelaae.
00485161   1/1  --lsleeaAalplagltaylallllldlagllpgktvlvtGAa..ggiGsaaaqllaalGarViavdrse
00421801   1/1  -------DgigavsllkrllvdlpgkkvlvlGaG...giGralalalaaagaevvvvnrt...lekaeel
00430421   1/1  -------MkgmkvlvtGgt..GfiGshlvraLleaGhevvvlvRnpskgkaaklelleellglgvevveg
00484141   1/1  --dyiglvnllkklgldlkgktvliiGa.G..gvGlaiaqalaalGakkVvlvdrdeekaqalveqlkel
00462911   1/1  ----------skkvLvTGat..GfiGsalvrrLlerGyeVialdrlssgsneekleellkelellgpgve
00519251   1/1  ----------kkkilvtGat..GfiGsalaraLlergyevialdr...spekleellkll..vefvkgDl
00387841   1/1  ----------kkvlvtGAs..GgiGsalalllakegaevvlvdrdeekalealagelldlgggalvlvad
00354771   1/1  ------MlkgmkvlVtGAa..GgiGsalalrlaarglagldllvevvlldrsealealegvaldlsdgal
00496861   1/1  --------------------tGgiGlavvrlllkrGykViaidrseekleklkelgad......vvldvt
00348721   1/1  -------fhpinvgdlvtgllfdnllpctpsgvlellkatgidlaGkvavVtGas..rgiGraiallLaa
00481861   1/1  ----------kkvlvtGAs..GgiGsalalllaargaevvlldrsp...eklegvaldlsdlgvevvvad


                         -         -         *         -         -         -         -:140
query           DLETIDSVFASLEQHWGKIDFVVHAIAFSDKDELTGRYLDTSRDNFNRTMDISVFSLAAVAKRAEPIMND
00499021   1/1  llelekllellaallelsdleggkalavaaDvtdeesvealvdaivekfgrldiLvnnagiage..llgp
00465921   1/1  lleleelleleaaleeleeleggralavaaDvtdeesvealvaaaveefgrldiLvnnagial..lllgp
00483611   1/1  lleleelleleaaleeledleggkalavaaDvtdeesvealvdaaverfgrldiLvnnagialll..ggp
00532661   1/1  deesvealveeileefgrldilvnnaGiagklellgplldlsledwervldvnllgtflltkaalplmrg
00499431   1/1  alDvtdeesvealveeileefgrldilvnnaGiaglslllgplldlsledwervldvnllgvflltkaal
00489491   1/1  deesvealveeileefgrldilvnnaGildldllllgplldlsledwervldvnllgvflltkaalplmr
00529881   1/1  vtdeesvealvaaavellgefgrldilvnnagialllllllgplldlsledwdrvldvnllgvflltraa
00450761   1/1  ggrvlavalDvtdeesvealveavleefgrldilvnnAgillp....gpleelsledfervldvnllgtf
00421311   1/1  DvtdealaeeleelelllllllesvealveaalerfgrldilvnnAgialvgallglllllllllkplld
00515681   1/1  DvtdeesvealveavleefgrldilvnnaGillpl...gplldlsledfervldvnllgtflltraalpl
00380421   1/1  alDvtdeesvealveaaleefgrldilvnnagillp....gplldlsledfervldvnllgtflltraal
00376621   1/1  valDvtdeesvealveaileefgrldilvnnagillp.....pllelsledfervldvnllgvflltraa
00503651   1/1  tdeesvealveeileefgrldilvnnagil....lpgplldlsledwervldvnllgvflltkaalplll
00394381   1/1  vtdeesvealveavleefgrldilvnnagillp....gplldlsledfervldvnllgtflltraalplm
00510061   1/1  alDvtdeesvealveavleefgrldilvnnaGialpgplegslldlsledfervldvnllgtflltraal
00350181   1/1  lDvtdeesvealveavleefggrldilvnnagillp....gplldltledfervldvnllgtflltraal
00437031   1/1  lDvtdeesvealveavleefgrldilvnnagillpllllgplldlsledfervldvnllgvflltraalp
00509671   1/1  alDvtdeesvealveevleefgrldilvnnAgialpgp..gllldlsledfervldvnllgtflltraal
00507761   1/1  Dvtdeesvealveevleefgrldilvnnagial....pgplldlsledfervldvnllgtflltraalpl
00532861   1/1  valDvtdeesvealveeileefggrldilvnnagilll....gplldlsledwervldvnllgvflltka
00525291   1/1  vtdeesvealveavleefgrldilvnnagil....lpgplldlsledfervldvnllgvflltraalpll
00471241   1/1  alDvtdeesvealveavleefgrldilvnnAgillp....gplleltledfervldvnllgvflltraal
00523681   1/1  deesvealveeileefgrldilvnnagilll....gplldlsledwervldvnllgvflltkaalplmrk
00451531   1/1  lDvtdeesvealveaileefggrldilvnnagillp....gplldltledfervldvnllgvflltraal
00464831   1/1  lDvtdllelleleleelleleleesvealveeileefgrldilvnnAGialpgpllllkslllsellgsl
00424291   1/1  deesveaaveel....ggldvlvnnagiall....gplldlsledfervldvnllgtflltraalplmrk
00425051   1/1  deesvealveaaveefgrldiLvnnagiall...lgplldlsledwdrvldvnllgvflltraalplmlk
00380681   1/1  lDvtdeesvaalveavleefgrldilvnnagillv....gplldlsledfervldvnllgtflltraalp
00369221   1/1  lDvtdeesvealvaavleefgrldilvnnagilld....gplldltledfervldvnllgtflltraalp
00387701   1/1  tdeesvealveavleefgrldilvnnAgialp....gplldlsledfervldvnllgtflltraalplmr
00361941   1/1  vtdeesveaaveel....ggldvlvnnagialp....gplldlsledfervldvnllgtflltraalplm
00512791   1/1  deesvealveavleefgrldilvnnagillv...lgplldlsledwervldvnllgtflltraalplmrk
00519651   1/1  lDvtdeesvealveevleefgrldilvnnAgilgp..llgplldlsledfervldvnllgtflltraalp
00416101   1/1  Dvtdeesvealveavleefgrldilvnnagillp....gplldltledfervldvnllgtflltraalpl
00502371   1/1  lDvtdeesvealveavleefgrldilvnnagill....pgplldlsledfervldvnllgvflltraalp
00398711   1/1  tdeesvealvaavleefgrldilvnnAgillv....gplldlsledfervldvnllgtflltraalplmr
00474701   1/1  lDvtdeesvealveavleefgrldilvnnagillp...lgplldlsledfervldvnllgvflltraalp
00503831   1/1  leelaaeleallggrvlavalDvtdeesvealveeileefgrldilvnnAgilav....gpledlsledf
00413661   1/1  tdeesvealveavleefgrldilvnnagillp....gplldlsledfervldvnllgtflltraalpllr
00517631   1/1  Dvtdeesvealvee....fgrldilvnnagill....vgplldlsledfervldvnllgtflltraalpl
00517021   1/1  tdeesvealvaavleefgrldilvnnagilll....gplldlsledwdrvldvnllgtflltraalplml
00514401   1/1  lggrvlavalDvtdeesvealveeileefgrldilvnnAgilav....gpledlsledfervldvNvlgt
00385451   1/1  tdeesvealvaealeefgrldilvnnAgillv....gplldlsledfervldvnllgtflltraalpllr
00520851   1/1  tdeesvealveavleefgrldilvnnagil....lpgplldlsledfervldvnllgtflltraalpllr
00509551   1/1  valDvtdeesvaalvaavleefgrldilvnnAgillp....gpllelsledwervldvnllgtflltraa
00499421   1/1  deesvealvaavleefgrldilvnnagilld....gplldltledfdrvldvnllgtflltraalplmrk
00368061   1/1  tdeesvealveaaleefgrldilvnnAgillpllllllgplldlsledfervldvnllgtflltraalpl
00388141   1/1  tdeesvaalvaavleefgrldilvnnagvlld....gplldltledfervldvnllgtflltraalpllr
00416921   1/1  de......veaaleafgrldilvnnagiall....gplldlsledwdrvldvnllgvflltraalplmlk
00468011   1/1  deesvealveavleefggrldilvnnAGialpgpll...........ervldvNllgtflltraalpllr
00510931   1/1  rvlavalDvtdeesvealveavleefgrldilvnnAgillp....gpledltledwervldvNllgvfll
00482431   1/1  DvtdeesvlellealveavleefgrldilvnnaGialpgpllgllllllllldlsleadwervldvnllg
00528731   1/1  DvtdeesvealveevleefgrldilvnnaGil............sledfervldvnllgtflltraalpl
00476811   1/1  rvlavalDvtdeesvealveav..efgrldiLvnnAGialp....gpleelsledwervldvNllgtfll
00500221   1/1  deesvaalvaavleefgrldilvnnagilll....gplldltledfdrvldvnllgvflltraalplmrk
00513551   1/1  DvtdeesvealveeileefgrlgldilvnnAgillpl...gplldlsledfervldvNllgtflltkaal
00482861   1/1  vqlDvtdeesvealveevleefgrldilvnnAGil......gpledlsledfllervldvNvlgtflltr
00519551   1/1  vlavalDvtdeesvealveeileefgrldilvnnagil....lpgplldlsledwervldvnllgvfllt
00506551   1/1  valDvtdeesvealveeileefgrldilvnnAGil.....vgpledlsleldfervldvNllgtflltka
00354711   1/1  DvtdeesveaaveavleefggldvlvnnAgillvlllllgpledlsledwervldvNvlgtflltraalp
00436781   1/1  tdeesvealvaaaleefgrldilvnnAgillpllllllgplldlsledfervldvnllgtflltraalpl
00383421   1/1  avalDvtdeesvealveaaleefgrldilvnnAgilld....gplleltledwervldvnllgtflltra
00512601   1/1  alDvtdeesvealveevleefgrldilvnnAgill....vgplldlsledfervldvnllgtflltraal
00512031   1/1  valDvtdeesvealveeileefgrldilvlnnAGill....pgpled.sledwervldvNllgtflltka
00511091   1/1  grvlvvaaDvtdeesvealveeileefgrldilvnnAgillp...dgpled.sledfervldvNvlgtfl
00527441   1/1  aaDvtdpesvealvaeileef.gldvlvnnAgill....vgpledlsledfervldvnvlgtfnllraal
00515111   1/1  valDvtdeesvealveavlellleefgrldilvnnAGillpl.llgplleltledwdrvldvnllgvfll
00515421   1/1  avalDvtdeesvaalvaavleefgrldilvnnAGilld....gpleeltledwervldvnllgaflltra
00498451   1/1  deesvealvaaale.fgrldilvnnAgillpllllgplldlsledwdrvldvnllgtflltraalplmrk
00486141   1/1  deeavealveaaveafggldvlvnnagill...plgplldlsledwdrvldvnllgtflllraalpllvk
00409101   1/1  alDvtdelesvealveealeefgridilvnnAGi............lsledwervldvNllgtflltraa
00353051   1/1  alDvtdelesvealveevleefgrldilvnnAGi............lsledwervldvNllgvflltraa
00417571   1/1  valDvtdeesvealveavlellleefgrldilvnnAGillplll.gpllelsledwdrvldvnllgvfll
00385591   1/1  deeavaalvaaavellefggldvlvnnagilavge...plldlsledwdrvldvnllgtflllraalplm
00480351   1/1  alaaelgalgralavaadvtdpesvealv.......ggldilvnnagilgal..lgplldltledwervl
00507211   1/1  ltdpeslaaalagv.....riDvvvhnAgi........plvdlseedpeevldvNvlgtlnlleaa..rk
00498641   1/1  egDltdpealeaaleev.....gvdvvihlAgissv........dlseedpeevldvNvlgtlnlleaar
00493571   1/1  elealggslllggvefvqgDltdpesleaala.......gvdvvvhnAgivgv........dlseedpee
00460341   1/1  vqgDltdpeslaaalagv.....riDvvihnAgivsv........dlseedpeevldvNvlgtlnlleaa
00482931   1/1  efvqgDltdpeslaaalagv.....rldvvvhnAgissv........dlseedpeevldvNvlgtlnlle
00490261   1/1  lldellggrvefvegDltdpesleaaleev.....gvDvvvhnAgissv....gpse.ltledpeevldv
00465741   1/1  efvqgDltdpeslaaaleev.....gvdvvihnAgi........plvdlseedpeevldvNvlgtlnlle
00495191   1/1  efvqgDltdpeslaaalagv.....rldvvvhnAgivgv........dlseedpeevldvNvlgtlnlle
00430411   1/1  gDltdpeslaealk.......gvdvVihlag....................dvnvlgtlnlleaakka..
00468971   1/1  Dltdpeslaaalagv.....ridvvihnAgiv........lvdlseedpeevldvNvlgtlnlleaalpa
00479651   1/1  kVvvtdinpealeaaaaelgaevvsggealavacdvtdpaavealidaavaafgkldilvnnAgiplvdp
00371281   1/1  tdpesleaaleev.ekfggvdvvihlAaissvd..........esdpeelldvNvlgtlnlleaarka..
00532871   1/1  ltdpdslaaala.......gvdavvhlagivgvgalllllllksllelseedpeevldvnvlgtlnllea
00514911   1/1  vqgDltdpeslaaaleev.....gvdvvvhnAgivgv........dlseedpeevldvNvlgtlnlleaa
00511831   1/1  ggdpgvelvvgDltdpesleaale.......gvdvvihlAgiasvg...........edpeelidvNvlg
00491171   1/1  efvqgDltdpeslaaala.......gvdvvvhnAgivsv........dlseedpeevldvNvlgtlnlle
00367851   1/1  tdeasldaal.......gdaDvvinaapvglh....aeiveaaleagkhvvdenpla..aetralleaak
00400431   1/1  ltdpealeaala.......gvdaVvhlAalshv........dlseedpeevlevNvlgtlnlleaarka.
00433371   1/1  gDltdpeslaaalagv.....rpdvvvhlAalssv........dlseedpeevldvNvlgtlnlleaare
00464721   1/1  tdpeslaaalagv.....rvdvvihlAgi.......vsavdlseedpeevldvNvlgtlnlleaarka..
00494281   1/1  dvtdeesieelaaeveellgdggldvlinnAGillpsg...slgeldleellevfevnvlgpllltqall
00383241   1/1  llllellgprvefvegDltdpealaaala....efggvdvVihlAalvhv........dlseedpeevld
00465291   1/1  neekleelaeeieaaggk.avvldvsdeedlkelv.......grlDilvnnagipl....lkplldltke
00419991   1/1  gDltdpealaalleei.....gvdaVihlAaissv........dlseedpeevldvNvlgtlnlleaark
00519911   1/1  e..gvevvvgDltdpeslaaalk.......gvdvvinaagitrvg...........edleefldvnvdgt
00527221   1/1  .gvevvvgDltdpeslaealk.......gvdvvinaagttrfg...........edleeflavnvdgtln
00485161   1/1  eklell....kelgad..vvidvtdedaveal......agggvdvvvnnag....gatlgallel.lapg
00421801   1/1  aeelga....qgdvsdleeleeal.......ggaDivvnatgaglpg....lllelllellkpggvvvdv
00430421   1/1  Dltdpeslaealk.......gvDvVihlagl...................evidvnvlgtlnlleaakea
00484141   1/1  gskikvkavsldvgdveele.......ellgkvDivinaaglgep....aklldllvellervksgnvlg
00462911   1/1  fvkgDltdpesleealkgv.....kpdvvihlAaivhv........dlseedpeetidvNvlgtlnllea
00519251   1/1  tdpesleealkg.......vdvvihlAaivgv........dlseedpeetidvNvlgtlnlleaarkagv
00387841   1/1  vtdleavedlv....ealggadvvvnnagvp..........rkpgeerldllevnvlgtknlaealkka.
00354771   1/1  avlldltdtddlaealk.......gadvvvhlagv..........prkpgedrddllavnvlgtrallea
00496861   1/1  d...veellkallk.lggvdvvihtag........apvtelslsllkqllrvnvlgtlnllrallpllvk
00348721   1/1  agatVtvcdrd......tedleelvkeadivvtavgvpdlvk.......aelgkpgalVnnaGi......
00481861   1/1  ltdpeslaealkg.......advvviaagip..........rkpgedrldlldvnvlgvknlleaaaka.


                         +         -         -         -         -         *         -:210
query           GGSIITLTYYGAEKVMPNYNVMGVAKAALEASVRYLAVDLGNRGIRVNAVSAGPIKTLAASGIGDFRYIL
00499021   1/1  lldlsledwdrvldvnllgvflltkaalplmkkggsIvnissiaglrglpglalayaasKaAlegltrsl
00465921   1/1  lldlsledwdrvldvnllgvflltraalplmrgggsivnissvaglvglpglalayaasKaAlegltrsl
00483611   1/1  lldlsledwdrvldvnllgvflltqaalplmkkggsIvnissiaglvglpglalayaasKaAlegltrsl
00532661   1/1  ggrivnisSiagllglpglaaYaasKaalegltrslalelapkgirvnavapglvdTpllrglllpeell
00499431   1/1  plmrgggrivnisSvagllglpglaaYaasKaalegltrslalelapkgirvnavaPglvdTpllrglll
00489491   1/1  gggrivnissvagllglpglaaYaasKaalegltrslalelapkgirvnavaPglvdTpllrglllleel
00529881   1/1  lplmreggsivnissv.gllglpglaayaasKaalegltrslalelaprgirVnavaPgpirTpllaall
00450761   1/1  lltraalplmlkrgrivnisSvaglllglpglaaYaasKaalealtrslalelaprgirvnavapglvdT
00421311   1/1  lsledwdrvldvnllgtflltraalplmrkrsaessggggrivnisSvagllglpglaaYaasKaalegl
00515681   1/1  mrkrgggrivnisSvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvdTpllrglla
00380421   1/1  plmrkrglggrivnisSvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvdTpllrg
00376621   1/1  lplmrkrgggrivnisSvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvdTpllag
00503651   1/1  mrkrgggrivnisSvagllglpglaaYaasKaalegltrslalelapkgirvnavapglvdTpllrgllg
00394381   1/1  lkrgrivnisSvaglllglpglaaYaasKaalealtrslalelaprgirvnavapglvdTpllagllall
00510061   1/1  plmlkrggrivnisSlvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvdTpllrgl
00350181   1/1  pllrkrgggrivnisSvagllglpglaaYaasKaalealtrslalelaprgirvnavapglvdTpllaal
00437031   1/1  llrkrggrivnisSvagllvglpglaaYaasKaalegltrslalelaptgirvnavaPglvdTpllrgll
00509671   1/1  plmlkrggrivnisSlvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvdTpllrgl
00507761   1/1  mrkrgggrivnisSvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvdTpllrglla
00532861   1/1  alplmrkrgggrivnisSvagllglpglaaYaasKaalegltrslalelapkgirvnavapglvdTpllr
00525291   1/1  rkrgggrivnisSvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvdtpllallgll
00471241   1/1  plmrkrglggrivnisSvagllallllllglpglaaYaasKaallgltrslalelaprgirvnavaPglv
00523681   1/1  rgggrivnisSvagllglpglaaYaasKaalegltrslalelapkgirvnavaPglvdtpllrgllllll
00451531   1/1  plmrkrgggrivnisSvagllglpglaaYaasKaalealtrslalelaprgirvnavapglvdTpllaal
00464831   1/1  ldlsledwer.ldvNllgvflltkaalplmkkaaklskrgggrivnisSvaglrglpglaaYsasKaale
00424291   1/1  aglggrivnissvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvltpllralllle
00425051   1/1  rgggrivnisSvaglvglpglaaYaasKaallgltrslalelaprgirvnavaPglvdTpmlaalllgll
00380681   1/1  lmrkrglggrivnisSvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvdTpllral
00369221   1/1  lmrkrgggrivnisSvagllglpgqaaYaasKaalealtrslalelaprgirvnavapglvdtpllaal.
00387701   1/1  krggrivnisSvagllglpglaaYaasKaalegltralalelaprglgirvnavapglvatpllrgllll
00361941   1/1  rkrglggrivnissvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvatpllralll
00512791   1/1  rggrivnisSvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvdTpllrglllllll
00519651   1/1  lmrkrgggrivnisSvagllglpgllaaYaasKaalegltrslalelaprgirvnavaPglvdtpllaal
00416101   1/1  mrkrglggrivnisSvagllglpglaaYaasKaalegltrslalelllaprgirvnavapglvdtpllag
00502371   1/1  llrkrgggrivnisSvagllgglpglaaYaasKaalegltrslalelaprgirvnavapglvdTpllagl
00398711   1/1  krglggrivnisSvagllglpglaaYaasKaalealtrslalelaprgirvnavapglvatpllagllll
00474701   1/1  llrkrgggrivnisSvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvdTpllrgll
00503831   1/1  ervldvNllgtflltraalplllkrglggrivnisSvagllglpgqaaYaasKaalegltrslalelapr
00413661   1/1  krgggrivnisSvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvdtplleallell
00517631   1/1  lrkrgggrivnisSvaglllglpglaaYaasKaalegltrslalelaprgirvnavapglvdtpllrgll
00517021   1/1  krgrivnisSvagl.glpglaaYaasKaalegltrslalelaprgirvnavapglvdtpllaal..leel
00514401   1/1  flltraalpllrkrgggrivni.SvagllglpgqaaYaasKaalegltrslalelaprgirvnavaPglv
00385451   1/1  krgggrivnisSvagllglpglaaYaasKaalealtrslalelaprgirvnavapglvatpllagl..lp
00520851   1/1  krgggrivnisSvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvdtpllaal..le
00509551   1/1  lplmrkrgldggrivnisSvagllglpllglaaYaasKaalegltrslalelllaprgirvnavapglvd
00499421   1/1  rgggrivnisSvagl.glpgqaaYaasKaalegltrslalelaprgirvnavapglvdtpllaal..lee
00368061   1/1  mrkrgaesgggggrivnisSvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvdtpl
00388141   1/1  krgggrivnisSvagllglpgqaaYaasKaalealtrslalelaprgirvnavapglvatpllaal..le
00416921   1/1  rgggrivnissvagllglpglaaYaasKaalegltrslalelaprgirvnavaPglvdTpllagll.dee
00468011   1/1  krgggrivnisSlavygalldlpllelllllllldlledvaglrglplglaaYaasKaalegltrslale
00510931   1/1  traalp.mlkrgggrivnisSvagllglpglaaYaasKaalegltrslalelaprglgirvnavaPGlvd
00482431   1/1  vflltraalpllrggglssglggrivnisSvagllglpglaaYaasKaalegltrslalelaprgirvna
00528731   1/1  lrkrglggggrivnisSvagllglpglaaYaasKaalegltrslalllelaptgirvnavapglvrtpll
00476811   1/1  traalplmrkrgggrivnisSvagllglpglaaYaasKaalegltrslalelaptgirvnavaPGlvdTp
00500221   1/1  rgggrivnisSvagllglpgqaaYaasKaalealtrslalelaprgirvnavapglvdtpllaal..lee
00513551   1/1  plmkkrgalssgellslgggrivnisSiagllglpglgllelplaaYaasKaalegltrslalelapkgi
00482861   1/1  aalplllkggrivnvsSvagllglpglddllleelllsdllllllldlllelldlllplledtplgplaa
00519551   1/1  kaalplmkkrgggrivnisSvagllglpglaaYaasKaalegltrslalelapkgirvnavapglvdtpm
00506551   1/1  llplmkksgrivnisSiagllglpdlglllleelllddlllldllellslllelllealleelllglaaY
00354711   1/1  lmrkaggrivnisSvaglgglpglaaYaasKaalegltrslarelap.girvnavapglvdtpllrglll
00436781   1/1  mrkrgaesglgggrivnisSvagllglpglaaYaasKaalegltrslarelaprgirvnavapglvatpl
00383421   1/1  alplmrkrglgrivnisSvagllglpgqaaYaasKaalegltrslalelaprgirvnavapglvatplte
00512601   1/1  plmrkrgggrivnisSvagllglpglaaYaasKaalegltrslalelaplgltgirvnavapglvdtpll
00512031   1/1  alplmkrgggrivnisSiagllglpgqaaYaasKaalegltrslalelllapkgirvnavaPGlvdtpll
00511091   1/1  ltraalp.lrkrglgrivnisSiagllglpgqaaYaasKaalealtrslalelallprgirvnavaPGlv
00527441   1/1  pl..gvgrivniSSiagvlgspgqsaYaasKaalealtrslaae....girvnavrpglvatp.....gl
00515111   1/1  traalplmrkrgllggrivnisSvagllglpglaaYaasKaallgltrslalel..tgirvnavaPglvd
00515421   1/1  alplmrkrgggrivnisSvagllglpgqaaYaasKaallgltrslalelaprgirvnavaPGlvdTpmta
00498451   1/1  rgaasgggggrivnisSvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvdtpllag
00486141   1/1  ggrivnisSvagygplpglaaYaasKaavegltrslalelapllkgirvnavapglvdtpllralgdg..
00409101   1/1  lplmrkrglglggrivnisSvagllglpglaaYaasKaalegltrslalelaptgirvnavapglvdTel
00353051   1/1  lplmrkrglglggrivnisSvagllglpglaaYaasKaalegltrslalelaptgirvnavaPglvdTpl
00417571   1/1  traalplmrkrgllggrivnisSvagllglpglaaYaasKaallgltrslalel..tgirvnavaPglvd
00385591   1/1  vkggrivnissvaglgglpglaaYgasKaavegltrslalelapllkgirvnavapgnvdtpmlrglldg
00480351   1/1  dvnllgtflltraalplmlarggrivnissiagllglpglaaYaasKaallgltr---------------
00507211   1/1  agtvgrivnvSSagvygdpglggpidEddpldplspYgasKaaaeallralarelaptglllelgirvti
00498641   1/1  ka..gvgrivfiSSaavyggseegpidEddpldpplspYgasKaaaellaralarel..ygirvvilrpg
00493571   1/1  vldvNvlgtlnlleaalpa..gvgrivniSSigvyggpggapidEddplnplspYgasKaaaeallrala
00460341   1/1  lpagvkrggggglslrivfiSsiavygglpgqsgpitEddpldplspYgasKaaaeallralarel...g
00482931   1/1  aalpagvkrggggrivniSSigvyg....dpggpidEddplnplsaYgasKaaaeallralarel...gi
00490261   1/1  Nvlgtlnlleaalpa.gvggrivfvSSiavygdpdgpidEddlllvllllllllltplpplsaYgasKaa
00465741   1/1  aalpa..gvgrivfvSSiavygdpdglpidEgdpglpplspYgasKaaaelllralare..gsgirvtil
00495191   1/1  aalpagvksggrivniSSiavygdpeglpidEdtplpplspYgasKaaaeallralarel...girvtil
00430411   1/1  ...gvkrfvfvSsagvygdedtplpplspygasKaaaeallral.......glpvtivrpgnvygpglsg
00468971   1/1  gvkrggggglslrivfvSSiavyggpggllevllesllgpldeddplnplspYgasKaaaeallralare
00479651   1/1  eallillergilyaPdilanAggva---------------------------------------------
00371281   1/1  .gvrfvytSSaavyggppglpidEdtplnplspYgasKaaaellvralare...yglrvvilrpgnvygp
00532871   1/1  akaa..gvkrivlvSslgayggdedtplpplspygasKaaaeallra.......sglrvtilrpglvlgp
00514911   1/1  lpa..gvgrivfvSSiavyggllllppglpidEddplnplspYgasKaaaelllral-------------
00511831   1/1  tlnlleaarka..gsvkrivfvSSiaavygdplllpglpidEdtwldvdllaalllllelplpplspYga
00491171   1/1  aarka..gvgrivfvSSigvyggpgglpidEdtplpplspYgasKaaaeallralarel...glrvtilr
00367851   1/1  eagvgrivnvssaagyadgrglpayqaakaalealllglalelgiagirvnailpgfve-----------
00400431   1/1  ..gvrfvfiSSaavyggspllllllglllldglpidEdtpldplspYgasKaaaellvrayare...ygl
00433371   1/1  a..gvvgrivfvSSaavyggppglpidEdtplnplspYgasKaaaellaralare...yglrvvilrpgn
00464721   1/1  gvkrivfvSSiavyggpgglpidEddllllplnplsapYgasKaaaelllralarel...glrvtilrpg
00494281   1/1  pllkkgaakksgeglslsralivnissllGsigdntsgglyaYrasKaALnmltksl-------------
00383241   1/1  vNvlgtlnlleaarka..gvkrfvfaSSaavyggnplllllddelpidEddplnplspYgasKaaaeklv
00465291   1/1  gwdvidvgvldvnllgvfll--------------------------------------------------
00419991   1/1  a..gvkprfvfiSSaavyggspgqpldesllldvdllpllaitEdtplnplspYaasKaaaealarayar
00519911   1/1  lnlldaakka..gvkrfvlvSslgalgpspsp..yaasKaaaeallral.......gldlvtivrpglvl
00527221   1/1  laeaakka..gvkrfvlvSslgalg..pspspyaasKaaaeallral.......glprvtivrpglvlgp
00485161   1/1  grvvlvnllggllltrallplllkrgkgrivns...............s---------------------
00421801   1/1  aypp.llttallplararglgrivdglsmlvlqgapgfely-----------------------------
00430421   1/1  ...gnvkrfvfvSsagvygdedtplnplspygasKaaaekllra.......sglpvtilrpgnvygpgls
00484141   1/1  dlllapevlplleeasekgirvvtglsilgeqgpaqltl-------------------------------
00462911   1/1  arkagvksg..grfvfiSSsavyggppglpidEddplnplspYgasKaaaelllrayakey...glrvvi
00519251   1/1  rfvfiSSsavygdpkkgpidEddllllnplnplspYgasKlaaekllrayakey.---------------
00387841   1/1  .gpgrivvvsspagllglpalkvygaskaa----------------------------------------
00354771   1/1  arka..gvgrivvvssgnpvdilalvalep----------------------------------------
00496861   1/1  lgvkrivyissvgvvtplrglspYsasKaal---------------------------------------
00348721   1/1  nrlfdeetledwllvgdvnl--------------------------------------------------
00481861   1/1  .gvgrivlvssnpv.....dglayaaskaaleg...........sgldvnrv------------------


                         -         -         -         +         -         -         -:280
query           KWNEYNAPLKRTVTIEEVGKSALYLLSDLSTAVTGEIHHVDSGYHTIGMKAVDAPDISVVKD--------
00499021   1/1  alelaprlgIrVnavaPGpikTpmlaallgllaellllslllllllllsll-------------------
00465921   1/1  alelaprlgirVnavaPgpidTpllaalladeelleallariplgrl-----------------------
00483611   1/1  alelaprlgIrVnavaPgpiltpmlaallgalllleelleallariplgrlg------------------
00532661   1/1  eallkliplgrlgtpedvadavlflasdaasyitgqvlvvdgGllllll---------------------
00499431   1/1  leelleallkliplgrlgtpeevadavlflasdaasyitgqvlvvdgG----------------------
00489491   1/1  leallkliplgrlgtpeevadavlflasdaasyitgqvlvvdgGlllllls-------------------
00529881   1/1  aalaallllllleelleallaliplgrllgtpeevanavlflasdaasy---------------------
00450761   1/1  pmlaalllllllllllilvleelleallaliplgrlgtpeevaeav------------------------
00421311   1/1  trslalelaprgirvnavaPglvdTpmlral...pelleallaliplgr---------------------
00515681   1/1  llllllllllllllpeevaeallaliplgrlgtpedvadavlf---------------------------
00380421   1/1  llldeelleallaliplgrlgtpeevaeavlflasdeasyitgqvlvvdgGltll---------------
00376621   1/1  ll.peelleallaliplgrlgtpeevaeavlflasdeasyitgqvlvvd---------------------
00503651   1/1  llallllllpeevaeallkliplgrlgtpedvagavlflasdaasyi-----------------------
00394381   1/1  lllllllllpeelleallaliplgrlgtpeevaeavlflasdaas-------------------------
00510061   1/1  lapeelleallellellldliplgrlgtpedvadavlflasdaasly-----------------------
00350181   1/1  llllllleelleallaliplgrlgtpeevaeavlflasdeasyitgqvlv--------------------
00437031   1/1  llllllllleelleallaliplgrlgtpeevaeavlflasdpeasyi-----------------------
00509671   1/1  lalllllllllelleallaliplgrlgtpedvadavlflasdelasyitgqvlvvdgGll----------
00507761   1/1  llllllllllpeevaealldliplgrlgtpedvadavlflasdaasy-----------------------
00532861   1/1  gll.deelleallkliplgrlgtpeevadavlflasdeasyitgqvlvvdggll----------------
00525291   1/1  gpeellelllalip..rlgtpeevadavlflasdaasyvtgqvlvvdgG---------------------
00471241   1/1  dTpllagl..peelleallaliplgrlgtpeevadavlflasdaasy-----------------------
00523681   1/1  lpeelleallkliplgrlgtpeevadavlflasdaasyitgqvlvvdggl--------------------
00451531   1/1  lllllleelleallaliplgrlgtpeevaeavlflasdeasyitgqvlvv--------------------
00464831   1/1  gltrslalelapkgirvnavaPGllvdTpllr.....eelleallklipl--------------------
00424291   1/1  ellaallaliplgrlgtpedvadavlflasdpasyitgqvlvvdgGl-----------------------
00425051   1/1  lllleelleallaliplgrlgtpeevadavlflasdaasyitGqv-------------------------
00380681   1/1  lalllllllllleevlealldliplgrlgtpedvaeavlflasdaas-----------------------
00369221   1/1  .leelleallaliplgrlgtpeevaeavlflalsdeasyitgqvlv------------------------
00387701   1/1  alleellallldgiplgrlgtpedvaeavlflasddasyitgqvlvvdg---------------------
00361941   1/1  leelleallaliplgrlgtpedvaeavlflasdpasyitgqvlvvdg-----------------------
00512791   1/1  leelleallaliplgrlgtpeevadavlflasd.asyvtgqvlvv-------------------------
00519651   1/1  lldleelleallalillplgrlgtpedvadavlflasdaasyvtgq------------------------
00416101   1/1  llp.eellelllaliplgrlgtpeevaeavlflasddasyitgqvlv-----------------------
00502371   1/1  lldeelleallaliplgrlgtpeevadavlflasdaasyvtgqvlvv-----------------------
00398711   1/1  llllllllleellealldgiplgrlgtpedvaeavlflasdeasyit-----------------------
00474701   1/1  pllllllpeevleallaliplgrlgtpedvadavlflasdaasyitgq----------------------
00503831   1/1  girvnavapglvdTpllrgllllpeelleallaliplgrlgtpedva-----------------------
00413661   1/1  al.......iplgrlgtpeevaeavlflasdeasyitgqvlvvdgGlllll-------------------
00517631   1/1  pllllpeelleallaliplgrlgtpedvadavlflasdaasyitGq------------------------
00517021   1/1  leallaliplgrlgtpeevaeavlflasdeasyitgqvlvvdgGlll-----------------------
00514401   1/1  dTpllaalllllpeellealldliplgrlgtpedvadavlflasdaa-----------------------
00385451   1/1  ellelllaliplgrlgtpeevaeavlflasdeasyitgqvlvvdgG------------------------
00520851   1/1  elleallaliplgrlgtpeevadavlflasdaasyvtgqvlvvdgG------------------------
00509551   1/1  tpllral..leelleallaliplgrlgtpedvaeavlflasdpa--------------------------
00499421   1/1  lleallaliplgrlgtpeevadavlflasdeasyitgqvlvvdgGlll----------------------
00368061   1/1  lagllg.eellelllaliplgrlgtpeevaeavlflasd..syvtgqv----------------------
00388141   1/1  ellelllaliplgrlgtpeevaeavlflasddasyitgqvlvvd--------------------------
00416921   1/1  llelllaliplgrlgtpeevaeavlflasdaasyitgqvlvvdgGllll---------------------
00468011   1/1  laprgirvnavaPglvdTpllrgllaleelleallalilplgrlgtpedvada-----------------
00510931   1/1  Tpllrgllae..........iplgrlgtpeevadavlflasdgas-------------------------
00482431   1/1  vaPglvdTpll....lpeelleallaliplgrllgtpeevadavlflas---------------------
00528731   1/1  agllpllllllleellealldliplgrlgtpedvaeavlflasd..syv---------------------
00476811   1/1  llrallaalallllllllllldllelleallaliplgrlgtpeev-------------------------
00500221   1/1  lleallaliplgrlgtpeevadavlflasdeasyitgqvlvvdgGl------------------------
00513551   1/1  rvnavapglvdTpllrgl.............All....tpeevaeal-----------------------
00482861   1/1  YaasKaalegltrslarelllllapkgirvnavaPglvdtpllrgll-----------------------
00519551   1/1  laallle...........plgrlgtpeevaeavlflasdeasyitgqvlv--------------------
00506551   1/1  aasKaalegltrslalelllllapkgirvnavaPGlvdtpllrgll...---------------------
00354711   1/1  pllllalllgellevlgdgiplgrlgtpedvadavlflasdpeasy------------------------
00436781   1/1  lagllg.eellealldliplgrlgtpedvaeavlflasd.------------------------------
00383421   1/1  rllrlgllllspeevaeallaallsgepvvvvgllllallllllee------------------------
00512601   1/1  aallaa............lgrlgtpedvaeavlflasdeasyitgq......ggl---------------
00512031   1/1  aalllalalllllllalallllaallaaaaaalllllaall.....qvlvvdggllllll----------
00511091   1/1  dtp........................................---------------------------
00527441   1/1  veellaellariplgrl.tpedvaravlfllsda..yvtgqvlvvdggl---------------------
00515111   1/1  Tdllaallldllleelleallaliplgrlgtpeevaeavlfla---------------------------
00515421   1/1  alle............plgrlgtpeevadavlflasdga.yitgqv------------------------
00498451   1/1  llp.eellallldgiplgrlgtpedvadavlflasd..syvtgqvlvvd---------------------
00486141   1/1  ........tplgrlgtpedvaeavlflasdaaslyitgqvlnvdgglllsvl------------------
00409101   1/1  lralllllalleelleallaliplgrlgtpeevaeavlflasdeasyitgq-------------------
00353051   1/1  lagllldpelleallaliplgrlgtpeevaeavlflasd...yvtgqvlvvdggllll------------
00417571   1/1  Tdllaalllglldpelleallaliplgrlgtpeevadavlfl----------------------------
00385591   1/1  ..........tplrrlgtpedvaeavlflasdeasyitgqvlnvdggltlsvle----------------
00480351   1/1  ----------------------------------------------------------------------
00507211   1/1  vrpgnvygpglgfpgnllplllraala...glplpvgdgdqvrdf-------------------------
00498641   1/1  nvygpglrpllgedplgalggllplllraalgkgepltvlgld---------------------------
00493571   1/1  rel...girvtivrpgnvygpglrplgvtgsllplllraalaggpl------------------------
00460341   1/1  irvtilrpgnvygpgggpgnllplllraalaglplpvlgdgdqvrd------------------------
00482931   1/1  rvtilrpgnvygpggrpglvtsllplflrlalaglpltlvlgdgdq------------------------
00490261   1/1  aelllralarel...girvtilrpgnvygpglrplgligellllldp-----------------------
00465741   1/1  rpgnvygpglspllgelllgvpdsllplflraalgglgplpvl---------------------------
00495191   1/1  rpgnvygpggrpllvtsllplflrlalaggplplvlgdgdqvrdfihvddvaravlllledp--------
00430411   1/1  ...iplllrlalkggpllilgdgdakrdfvhveDvaravvlal---------------------------
00468971   1/1  l...girvtilrpgnvygpggrpgnllplllraalagkplpvlgdg------------------------
00479651   1/1  ----------------------------------------------------------------------
00371281   1/1  ggrpdgltssviplllrlalagepltlvlgdgdqlrdfihvdDvadaillal------------------
00532871   1/1  llsglrlggll..llgdgdalrsfisvedvadavvlaledpa.---------------------------
00514911   1/1  ----------------------------------------------------------------------
00511831   1/1  sKaaaealaralarelap.glrvvilrpgnvygpglrptlvts---------------------------
00491171   1/1  pgnvygpgggpgnllplllraalaglpltvlgdgdqvrdfihvddv------------------------
00367851   1/1  ----------------------------------------------------------------------
00400431   1/1  rvvilrpgnvyGpggrpesliplllraalkggpltvfgdgdqv---------------------------
00433371   1/1  vygpggrpdgvtsnliplllrlalggepltvlgdgdqvrdfvh---------------------------
00464721   1/1  nvygpggrpllglsgvlprlirlallaalaglpvltvlgdgdqv--------------------------
00494281   1/1  ----------------------------------------------------------------------
00383241   1/1  rayare...yglpvvilrpgnvyGpggspllgeshvlptlllp---------------------------
00465291   1/1  ----------------------------------------------------------------------
00419991   1/1  e...yglrvvilrpgnvyGpggrp.glpsgvlpllirqilraa---------------------------
00519911   1/1  gpllspllgealllpgllllgdgdakrrpisvedvaravvaal---------------------------
00527221   1/1  lgeplpgelllaggllllgdgdakrspisvddvaralvaaled---------------------------
00485161   1/1  ----------------------------------------------------------------------
00421801   1/1  ----------------------------------------------------------------------
00430421   1/1  g..liplllklalkggpllilgdgdqkrdfihvdDvaravvl----------------------------
00484141   1/1  ----------------------------------------------------------------------
00462911   1/1  lrpgnvyGpgggpdgvtskviplliraalkgkplpilgdgdqtrdfihvdDvaeaillalek--------
00519251   1/1  ----------------------------------------------------------------------
00387841   1/1  ----------------------------------------------------------------------
00354771   1/1  ----------------------------------------------------------------------
00496861   1/1  ----------------------------------------------------------------------
00348721   1/1  ----------------------------------------------------------------------
00481861   1/1  ----------------------------------------------------------------------