[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for atum0:AAK86654.1


[Show Plain Result]

## Summary of Sequence Search
   1::140
   1::139  5.1e-42 50.4% 0041204 00412041 1/1   like                                    
   3::139  5.8e-40 50.0% 0044408 00444081 1/1   like                                    
   3::139  1.1e-39 47.4% 0044506 00445061 1/1   like                                    
   1::139  5.7e-37 49.6% 0041625 00416251 1/1   like                                    
   1::139  2.9e-33 41.4% 0040616 00406161 1/1   like                                    
   1::139    1e-31 39.6% 0044862 00448621 1/1   like                                    
   5::139    5e-17 29.7% 0040990 00409901 1/1   like                                    
   1::140


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPILYTTKASATGGRAGNAKSEDGVLDVTLTVPKELGGDGARGTNPEQLFAAGYSACFLGALKAVAGKHK
00412041   1/1  MselkilytatatwtggrdgtvssdggvldllldepvelggegetgtnPeellaaalaaCfalallavaa
00444081   1/1  --ilytatatwtggrksgdgrvtsesgglelqldapkelgg..gegtnPeellaaalaaCfaiallavae
00445061   1/1  --ilytatatwtggrngtvtsedgaldlildepvelggedgsgtnPeellaaalaaCfllallaiaakag
00416251   1/1  mdagrllllllellallklmkilytatatwtgglysrdgvvssddgvlelaldspkelgg.dgegtnPee
00406161   1/1  mkilytatatatggrrgevtssghellldl..p..lgg.ggegpnPeelllaalaaCflltlrlvakkkg
00448621   1/1  msllykvtvkwlggrrflattesg.helvldepkelggdg.tgpnPvelllaalaaCtaitllaiakkkg
00409901   1/1  ----mkvsvkwvgglrflatvgrg.....htillde.ggddtgpnPeelllaAlagClaidllailkkkg


                         -         -         *         -         -         -         -:140
query           VKIPEDTTVTATVGIGPREDGTGFGIEVTLKVNIPGLEREKAEELVAAAHIVCPYSHAMRTSTEVPVSVA
00412041   1/1  kagielpedleveaevtldkdgggf..flkvtlrvtvpgldeeeaeelvelAhkvCpvsnalrgnidve-
00444081   1/1  kkgid.lesleveaevdldkeeggfgitkirltlevklpgldeeeaeklvekAhkvCpvskalrgniev-
00445061   1/1  idleseleveaevtldkegggff..ielrltvtlpgldeeeaeellelAhkvCpvskalrgnidvelel-
00416251   1/1  lllaAlaaCfslallavaakkgie.vesleveaevdldkegdgfgftkirltlrvtlpgldeeqaekll-
00406161   1/1  iple.dlevevegdldldgedgpfgltsirlhvtldgdldeeeaeellelaekvCpvsntlrgnievel-
00448621   1/1  itldledlevevegerdedgpgvftaieirltvelpgdldeeeleklvelalekyCpvsntlrggievt-
00409901   1/1  i.dledlevevegeldeegpfvftkieltvrvdgpdldeeklerlvelalekyCpvsrtlrggveievs-