[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for atum0:AAK86734.2


[Show Plain Result]

## Summary of Sequence Search
   1::435
 101::437  2.1e-55 27.9% 0052485 00524851 1/1   lactamase/transpeptidase-like           
 100::429  6.8e-55 29.1% 0038040 00380401 1/1   lactamase/transpeptidase-like           
 122::405  2.5e-54 28.9% 0046070 00460701 1/1   lactamase/transpeptidase-like           
  99::430  3.9e-54 28.5% 0046147 00461471 1/1   lactamase/transpeptidase-like           
 103::406    7e-54 30.0% 0038744 00387441 1/1   lactamase/transpeptidase-like           
  95::429  2.3e-53 27.6% 0037741 00377411 1/1   lactamase/transpeptidase-like           
 122::405  1.9e-49 29.3% 0046565 00465651 1/1   lactamase/transpeptidase-like           
 122::432  4.6e-13 20.7% 0049712 00497121 1/1   lactamase/transpeptidase-like           
 126::428  1.4e-09 24.1% 0051055 00510551 1/1   lactamase/transpeptidase-like           
 118::429  4.3e-08 23.9% 0046422 00464221 1/1   lactamase/transpeptidase-like           
  98::405  5.4e-08 21.7% 0046929 00469291 1/1   lactamase/transpeptidase-like           
 125::437    8e-08 21.8% 0046438 00464381 1/1   lactamase/transpeptidase-like           
 125::430  5.6e-06 20.6% 0048511 00485111 1/1   lactamase/transpeptidase-like           
 128::402  0.00053 20.1% 0048305 00483051 1/1   lactamase/transpeptidase-like           
   1::435


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLAAVLPVLVFPHGASSQVATPLSAEQSDPLKLGWMQGFPPPEDKIIRFSDSDYFNFPKSRWTVCHFRQL
00524851   1/1  ----------------------------------------------------------------------
00380401   1/1  ----------------------------------------------------------------------
00460701   1/1  ----------------------------------------------------------------------
00461471   1/1  ----------------------------------------------------------------------
00387441   1/1  ----------------------------------------------------------------------
00377411   1/1  ----------------------------------------------------------------------
00465651   1/1  ----------------------------------------------------------------------
00497121   1/1  ----------------------------------------------------------------------
00510551   1/1  ----------------------------------------------------------------------
00464221   1/1  ----------------------------------------------------------------------
00469291   1/1  ----------------------------------------------------------------------
00464381   1/1  ----------------------------------------------------------------------
00485111   1/1  ----------------------------------------------------------------------
00483051   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           MPTVNVSRGLGAPAALERKLDPAMDAVTFRPTGADQDMTWLQSLSANYTDGIVVLHKGVLVYERYSGCLN
00524851   1/1  ------------------------------dellaaldalleelleagipgaavavvkdgkvvyekayGy
00380401   1/1  -----------------------------vlglsddllaaldalleelleeggipGaavavirdgkvvy.
00460701   1/1  ---------------------------------------------------ladellealdalleellee
00461471   1/1  ----------------------------sdellealdalleelleeggipGaavavvrdgkvvyekayGy
00387441   1/1  --------------------------------lsdellealdelleklleeggipGaavavikdgk.vye
00377411   1/1  ------------------------vlglvddllaavdelleklleeggipGaavavirdgkvvy.rayGv
00465651   1/1  ---------------------------------------------------alrldalddlledllaegg
00497121   1/1  ---------------------------------------------------mmmkkilllllllllllla
00510551   1/1  -------------------------------------------------------fdagaggavvldlkt
00464221   1/1  -----------------------------------------------dlqsalddalqkllkepgargav
00469291   1/1  ---------------------------sldaklqkaleallkelgasg..avvvidpktGevla......
00464381   1/1  ------------------------------------------------------seklqqaleallkdlg
00485111   1/1  ------------------------------------------------------edlvltldaklqalae
00483051   1/1  ---------------------------------------------------------dpklqkaleallk


                         +         -         -         -         -         *         -:210
query           EAGQHGAMSVTKSLTGLLGEMLVAEGTLDENAKVATVVPELEKSAFGDATIRQVLDMTTGLRYSEDYADP
00524851   1/1  adlesgrpvtpdtlfriaSvtKsftatailqlveeGkldlddpvskylPel..pgkediTlrhLLthtsG
00380401   1/1  rayGvadletgrpvtpdtlfriaSvtKsftatavlqlveeGklslddpvskylPefagsgkediTlrqLL
00460701   1/1  ggipGaavav.kdgkivyekayGyadlekgrpvtpdtlfriaSvtKsftatailqLveeGkldlddpvsk
00461471   1/1  adletgrpvtpdtlfriaSvtKsftatailqlveeGkLdlddpvskylPefalldvlpgkediTlrhLLt
00387441   1/1  rayGvadletgvpvtpdtlfriaSvtKsftatavlqlveeGklslddpvskylPefp..gkeditlrhLL
00377411   1/1  adletgrpvtpdtlfriaSvtKtftatavlqlveeGklslddpvskylPefagsgkeditirhLLtHtsG
00465651   1/1  vpgaavavvkdgkivyekayGyadletgvpvtpdtlfriaSvtKsftatailqlveeGkl.lddpvskyl
00497121   1/1  vaaaaaaaappelgapgavvldldtgkvlyek.....nadtrfppASltKlmtayavlelveeGklsldd
00510551   1/1  GevlaaknadtlfppaSttKlftalaalqlveeGklslddpvtvskylpefgg..gsgitirlllghtsg
00464221   1/1  vvidpktGev.la............rnadtrfppaSttKlftalaalelveeGklslddpvtdslpalvg
00469291   1/1  rnadtrfppaSttKlftalaalqlveeGklslddpvtdsppalklggsnvdlrvggsitlrdllthalg.
00464381   1/1  apgaavvvdvktGevla......ynpdtlfppaSttKlftalaalqlveeGklslddpvtdsplalvggk
00485111   1/1  elgargavvvidpktGevla......fnpdtrfppaSttKlftaaaalelveeGklslddpvtdspsayl
00483051   1/1  elgargaavvidpktGevlanrnadtrfppaSttKlftaaaalqlveeGklslddpvtdsppalvggspn


                         -         -         -         +         -         -         -:280
query           NADVWIYSAAGNPLPKPDGYEGPRSYFDYLKTVVKQGENGSAFGYKTINSDALGWVIARASGKSVAELLS
00524851   1/1  lpyyegllllv...............pellltldellellaalpllfepGtrfaYsnlgydllgliierv
00380401   1/1  thtsGlpyle....................ppedllsleelldllaalplvfppGtrflYsnlgyglLgl
00460701   1/1  ylPefagpgkediTirhLLtHtsGlpdyedlldl....................ldleellallaalpll
00461471   1/1  HtsGlpyyegyldl....ldlallglllllpealltleellallaalpllfepGtrfaYsn.gydllgli
00387441   1/1  thtsGlpyyfllld.......llallllllvpellldleellaylaalplvfepGtrfaYsnlnydlLgl
00377411   1/1  lpale....................dpedllsleelldllaalplvfppGtrfaYsnlgyglLgliierv
00465651   1/1  pela...addiTirhLLtHtSGlpdyedllll...........aglllpealltledllalllslpllfe
00497121   1/1  pv...............tisellthtsglpdgs.....................................
00510551   1/1  lrdllrga............................................lvySdNtaavllaellgg
00464221   1/1  gspkndlrvggsitlrdllthalglS......dNtaavalaerlaggpda....................
00469291   1/1  .......................................................ySdndaavllaerlg
00464381   1/1  ylppsnldlagggsitlrdllthal................glSdNdaavalaerlgGpealaeflrrlg
00485111   1/1  pgfpnadlrvggsitlrdllthalgl............................................
00483051   1/1  ydlkpggsitlrdllthalg..................................................


                         -         *         -         -         -         -         +:350
query           QRIWSRIGAEQDAYYTVDSTGTPFAGGGLNAGLRDMARIGQLLLDDGMAGGHRLIPQKAIDNIRHGGDKA
00524851   1/1  tgksleeylrerifePlgmt.dtgfglpdaelldrlatgyllgllglllalldllllgllldgevvdvpa
00380401   1/1  iiervtgksleellrerifePlgmkdtsfglpdallarlavgyapdgevvdvtpvllgaelgagglfsta
00460701   1/1  fepGtkfaYsnlgygllgliiervtGksleeylqerifePLgmtdtsflppdallrrlaagyyadgggll
00461471   1/1  iervtGksleellrerifePLgmt.dtsfglpdldrlatgyardggglllllplllaalalllllrllll
00387441   1/1  iiervtgksleellkerifePlgmk.dttfgvpdaelparlavgyaldgllggrvlpvpalllglelgag
00377411   1/1  tGksleellrerifePlgmtdtsfglpdalrdrlargyvpdgpapvdplgleagagglfstarDlarflq
00465651   1/1  PGtkfsYsnlgydlLgliiervtGkslaeylkerifkPLGmtdtafllddallarlaagyyvgglvlvpa
00497121   1/1  .plllepgesytysdllyallvlSdNdaagalaervgG.sleafveemnaiakplGmtntrf..vnpsGl
00510551   1/1  .sgksfaeamnerlre.lGmtnttfvnp..sGldrklwepellaalsgggglysTardlarllrallngg
00464221   1/1  .vneparrlgysntgfdllglalgnvsglslg................................llsTpl
00469291   1/1  Gpeslaeflrklgfgptglgmtntlflnasgl...gggllsTpldlarllaalang......rllspeta
00464381   1/1  lgapllglpgttfynssgl..................................................g
00485111   1/1  .........SsNtaavllaellgg......adavne.ilkplGlgnttfvdlpgelnglglg..ggglls
00483051   1/1  ........ySdNtaavllaerlgGleafaeylnelgfgptglgltdttfgnasglder.....llsTpld


                         -         -         -         -         *         -         -:420
query           AFAKGGYPALRGWSYRAMWWVTHNANGAFMARGVHGQAIYVDPAADMVIARFSSHPVASNAANDPTSLPA
00524851   1/1  lnlgavsgagglfstarDlarflqallng......rllspetvdemltpql.....gvdltlggglgygl
00380401   1/1  rDlarflqallnggvldgkrllspetlremltpql............pglgyglgwelldlpvllsglla
00460701   1/1  vnlgalagagglfstarDlarflqallngglldgkrllsaetvdlmttpqlpslt---------------
00461471   1/1  lglvhdplgavagagglfstarDlarflqallngg.....rllspetldemltpql......pglppggg
00387441   1/1  glfstarDlarflqallng......rllspetlrlmltpq..........plgggl--------------
00377411   1/1  allnggvldgkrllspetlrlmltpql............pglgyglgwelldlpvllggllaglgleval
00465651   1/1  vnlggvagagglystarDlarflqallnggllsgeqllsmltvalmttpql....---------------
00497121   1/1  sddrlepelleallggggnysTarDlakllrallkggpllspitstllftfllgt........lrntnkl
00510551   1/1  .....pllspetaallltlll.......vvlygtgrlllraglpldgvvggKtGttggagadfvgvaprp
00464221   1/1  dlarllaalang......rvlspetaallldllrg........vvtygtgnrlllppggpvagKtGttnd
00469291   1/1  alllslligvvtggtgnrallpaggrvagKtGttlnggrslvgfapradgpviav---------------
00464381   1/1  ggllsTaldlarllaalang......rllspetaalllsllrgvvt........ygtgnrlllpaggrva
00485111   1/1  Tpldlarllaalang......rvlspetaallldlllpvvvgdgtgrlllppgvdvagKtGt........
00483051   1/1  larllaalang......rllspetaallldllrgvvtygtgnrallpaggpv------------------


                         -         -         +         -         -         -         -:490
query           YEAVARYLMGGAARP-------------------------------------------------------
00524851   1/1  gwwllddpgglafghgG-----------------------------------------------------
00380401   1/1  glglavlld-------------------------------------------------------------
00460701   1/1  ----------------------------------------------------------------------
00461471   1/1  lgyglgwwll------------------------------------------------------------
00387441   1/1  ----------------------------------------------------------------------
00377411   1/1  dplkvllll-------------------------------------------------------------
00465651   1/1  ----------------------------------------------------------------------
00497121   1/1  llraglpyggvv----------------------------------------------------------
00510551   1/1  grrlivvv--------------------------------------------------------------
00464221   1/1  agdawfvgy-------------------------------------------------------------
00469291   1/1  ----------------------------------------------------------------------
00464381   1/1  gKtGttqvvlGlagvaw-----------------------------------------------------
00485111   1/1  ..........------------------------------------------------------------
00483051   1/1  ----------------------------------------------------------------------