[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for atum0:AAK86736.1


[Show Plain Result]

## Summary of Sequence Search
   1::757
 288::671 2.8e-105 42.4% 0051964 00519641 1/1   lactamase/transpeptidase-like           
 334::691  3.9e-89 38.2% 0052119 00521191 1/1   lactamase/transpeptidase-like           
 366::672  1.1e-82 41.4% 0048985 00489851 1/1   lactamase/transpeptidase-like           
 366::680  2.6e-73 41.5% 0047727 00477271 1/1   lactamase/transpeptidase-like           
 366::686  6.8e-73 41.2% 0049225 00492251 1/1   lactamase/transpeptidase-like           
 367::678  7.2e-59 37.7% 0050287 00502871 1/1   lactamase/transpeptidase-like           
 388::669  3.5e-53 36.6% 0046452 00464521 1/1   lactamase/transpeptidase-like           
 377::671  2.6e-50 36.6% 0047733 00477331 1/1   lactamase/transpeptidase-like           
 371::670  1.8e-48 37.4% 0048423 00484231 1/1   lactamase/transpeptidase-like           
 373::671    4e-48 35.5% 0050891 00508911 1/1   lactamase/transpeptidase-like           
 377::676  1.2e-47 28.3% 0046438 00464381 1/1   lactamase/transpeptidase-like           
 366::665  6.3e-46 28.7% 0046929 00469291 1/1   lactamase/transpeptidase-like           
 368::668  2.7e-45 34.6% 0048110 00481101 1/1   lactamase/transpeptidase-like           
 363::676  3.3e-42 29.8% 0048511 00485111 1/1   lactamase/transpeptidase-like           
 368::668  1.2e-41 29.4% 0048305 00483051 1/1   lactamase/transpeptidase-like           
 368::667  6.5e-41 28.9% 0046014 00460141 1/1   lactamase/transpeptidase-like           
 370::667  1.4e-40 31.2% 0046422 00464221 1/1   lactamase/transpeptidase-like           
 382::667  5.9e-40 28.8% 0053342 00533421 1/1   lactamase/transpeptidase-like           
 378::671  6.2e-38 27.7% 0052144 00521441 1/1   lactamase/transpeptidase-like           
 382::632  8.6e-37 28.4% 0045791 00457911 1/1   lactamase/transpeptidase-like           
 377::667  5.9e-36 27.5% 0046008 00460081 1/1   lactamase/transpeptidase-like           
 377::666  1.2e-25 24.2% 0047476 00474761 1/1   lactamase/transpeptidase-like           
 380::665    1e-19 28.0% 0046343 00463431 1/1   lactamase/transpeptidase-like           
 394::662  7.6e-14 26.9% 0051055 00510551 1/1   lactamase/transpeptidase-like           
 401::657  1.4e-13 24.8% 0046615 00466151 1/1   lactamase/transpeptidase-like           
 377::673  5.4e-13 22.2% 0038811 00388111 1/1   lactamase/transpeptidase-like           
 392::660  9.6e-09 21.9% 0047175 00471751 1/1   lactamase/transpeptidase-like           
   1::757


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MVLRREWVETQKYRRAALPRTGKHRQVQEEKDDNKGRRKRHILLRIDSFIDSGLWTAAARLVDFWEDVTI
00519641   1/1  ----------------------------------------------------------------------
00521191   1/1  ----------------------------------------------------------------------
00489851   1/1  ----------------------------------------------------------------------
00477271   1/1  ----------------------------------------------------------------------
00492251   1/1  ----------------------------------------------------------------------
00502871   1/1  ----------------------------------------------------------------------
00464521   1/1  ----------------------------------------------------------------------
00477331   1/1  ----------------------------------------------------------------------
00484231   1/1  ----------------------------------------------------------------------
00508911   1/1  ----------------------------------------------------------------------
00464381   1/1  ----------------------------------------------------------------------
00469291   1/1  ----------------------------------------------------------------------
00481101   1/1  ----------------------------------------------------------------------
00485111   1/1  ----------------------------------------------------------------------
00483051   1/1  ----------------------------------------------------------------------
00460141   1/1  ----------------------------------------------------------------------
00464221   1/1  ----------------------------------------------------------------------
00533421   1/1  ----------------------------------------------------------------------
00521441   1/1  ----------------------------------------------------------------------
00457911   1/1  ----------------------------------------------------------------------
00460081   1/1  ----------------------------------------------------------------------
00474761   1/1  ----------------------------------------------------------------------
00463431   1/1  ----------------------------------------------------------------------
00510551   1/1  ----------------------------------------------------------------------
00466151   1/1  ----------------------------------------------------------------------
00388111   1/1  ----------------------------------------------------------------------
00471751   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           ASRKLHVRGWKKLVVNLTCDALTFGTAGSIVLLALAMPAFEETKKDWRYRGDFAVTFLDRYGNTIGHRGI
00519641   1/1  ----------------------------------------------------------------------
00521191   1/1  ----------------------------------------------------------------------
00489851   1/1  ----------------------------------------------------------------------
00477271   1/1  ----------------------------------------------------------------------
00492251   1/1  ----------------------------------------------------------------------
00502871   1/1  ----------------------------------------------------------------------
00464521   1/1  ----------------------------------------------------------------------
00477331   1/1  ----------------------------------------------------------------------
00484231   1/1  ----------------------------------------------------------------------
00508911   1/1  ----------------------------------------------------------------------
00464381   1/1  ----------------------------------------------------------------------
00469291   1/1  ----------------------------------------------------------------------
00481101   1/1  ----------------------------------------------------------------------
00485111   1/1  ----------------------------------------------------------------------
00483051   1/1  ----------------------------------------------------------------------
00460141   1/1  ----------------------------------------------------------------------
00464221   1/1  ----------------------------------------------------------------------
00533421   1/1  ----------------------------------------------------------------------
00521441   1/1  ----------------------------------------------------------------------
00457911   1/1  ----------------------------------------------------------------------
00460081   1/1  ----------------------------------------------------------------------
00474761   1/1  ----------------------------------------------------------------------
00463431   1/1  ----------------------------------------------------------------------
00510551   1/1  ----------------------------------------------------------------------
00466151   1/1  ----------------------------------------------------------------------
00388111   1/1  ----------------------------------------------------------------------
00471751   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           IHEDSVPIDQMPDHFIKAVLATEDRRFFDHFGIDFIGLARAMSENARAGGVVQGGSTLTQQLAKNLFLTN
00519641   1/1  ----------------------------------------------------------------------
00521191   1/1  ----------------------------------------------------------------------
00489851   1/1  ----------------------------------------------------------------------
00477271   1/1  ----------------------------------------------------------------------
00492251   1/1  ----------------------------------------------------------------------
00502871   1/1  ----------------------------------------------------------------------
00464521   1/1  ----------------------------------------------------------------------
00477331   1/1  ----------------------------------------------------------------------
00484231   1/1  ----------------------------------------------------------------------
00508911   1/1  ----------------------------------------------------------------------
00464381   1/1  ----------------------------------------------------------------------
00469291   1/1  ----------------------------------------------------------------------
00481101   1/1  ----------------------------------------------------------------------
00485111   1/1  ----------------------------------------------------------------------
00483051   1/1  ----------------------------------------------------------------------
00460141   1/1  ----------------------------------------------------------------------
00464221   1/1  ----------------------------------------------------------------------
00533421   1/1  ----------------------------------------------------------------------
00521441   1/1  ----------------------------------------------------------------------
00457911   1/1  ----------------------------------------------------------------------
00460081   1/1  ----------------------------------------------------------------------
00474761   1/1  ----------------------------------------------------------------------
00463431   1/1  ----------------------------------------------------------------------
00510551   1/1  ----------------------------------------------------------------------
00466151   1/1  ----------------------------------------------------------------------
00388111   1/1  ----------------------------------------------------------------------
00471751   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           ERSLERKIKEAFLALWLESNMSKKEILSLYLDRAYMGGGTFGAAAAAQFYFGKNLTDVTLSESAILAGLF
00519641   1/1  ----------------------------------------------------------------------
00521191   1/1  ----------------------------------------------------------------------
00489851   1/1  ----------------------------------------------------------------------
00477271   1/1  ----------------------------------------------------------------------
00492251   1/1  ----------------------------------------------------------------------
00502871   1/1  ----------------------------------------------------------------------
00464521   1/1  ----------------------------------------------------------------------
00477331   1/1  ----------------------------------------------------------------------
00484231   1/1  ----------------------------------------------------------------------
00508911   1/1  ----------------------------------------------------------------------
00464381   1/1  ----------------------------------------------------------------------
00469291   1/1  ----------------------------------------------------------------------
00481101   1/1  ----------------------------------------------------------------------
00485111   1/1  ----------------------------------------------------------------------
00483051   1/1  ----------------------------------------------------------------------
00460141   1/1  ----------------------------------------------------------------------
00464221   1/1  ----------------------------------------------------------------------
00533421   1/1  ----------------------------------------------------------------------
00521441   1/1  ----------------------------------------------------------------------
00457911   1/1  ----------------------------------------------------------------------
00460081   1/1  ----------------------------------------------------------------------
00474761   1/1  ----------------------------------------------------------------------
00463431   1/1  ----------------------------------------------------------------------
00510551   1/1  ----------------------------------------------------------------------
00466151   1/1  ----------------------------------------------------------------------
00388111   1/1  ----------------------------------------------------------------------
00471751   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           KAPAKYAPHVNLPAARARANTVLSNLVQSGLMTEGQVIGARRNPATVIDRADVKAPDYFLDWAFDEVQRL
00519641   1/1  -------PlrnperaleRrnlvLdrmvelg..........................pyfadlvrkellel
00521191   1/1  -----------------------------------------------------gkapyfvdavgrelrel
00489851   1/1  ----------------------------------------------------------------------
00477271   1/1  ----------------------------------------------------------------------
00492251   1/1  ----------------------------------------------------------------------
00502871   1/1  ----------------------------------------------------------------------
00464521   1/1  ----------------------------------------------------------------------
00477331   1/1  ----------------------------------------------------------------------
00484231   1/1  ----------------------------------------------------------------------
00508911   1/1  ----------------------------------------------------------------------
00464381   1/1  ----------------------------------------------------------------------
00469291   1/1  ----------------------------------------------------------------------
00481101   1/1  ----------------------------------------------------------------------
00485111   1/1  ----------------------------------------------------------------------
00483051   1/1  ----------------------------------------------------------------------
00460141   1/1  ----------------------------------------------------------------------
00464221   1/1  ----------------------------------------------------------------------
00533421   1/1  ----------------------------------------------------------------------
00521441   1/1  ----------------------------------------------------------------------
00457911   1/1  ----------------------------------------------------------------------
00460081   1/1  ----------------------------------------------------------------------
00474761   1/1  ----------------------------------------------------------------------
00463431   1/1  ----------------------------------------------------------------------
00510551   1/1  ----------------------------------------------------------------------
00466151   1/1  ----------------------------------------------------------------------
00388111   1/1  ----------------------------------------------------------------------
00471751   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           AAEGKFKDHTVVVRTTIDTGLQQAAEQAMEMELREYGEGYRVKQGAMVMIENGGGVRAMVGGRDYGESQF
00519641   1/1  lgldlalellytgglkiyttlDldlQkaaeealknallaldkklgalqgalvvldpktGevlAmvggpdy
00521191   1/1  lgllleevlptggldiyltldldlQkaaeealrkallal.dklgalqgavvvldpktGevlAmvggpdyd
00489851   1/1  ---------------TldldlQkaaeealkkalell....galqgaavvldpktGevlAmvggpdydpnl
00477271   1/1  ---------------TldldlQkaaeealdkalell....galqgaavvldpktGevlAmvggpdydpnl
00492251   1/1  ---------------TldldlQkaaeealdkalellga....lqgavvvldpktGevlAmvsspsydpnl
00502871   1/1  ----------------lDldlQkaaeealkd...........kqgavvvldpkTGeilAmvsgpsydpnl
00464521   1/1  -------------------------------------lalkaalgalvvldpktGravlalvgtgdyvln
00477331   1/1  --------------------------tlledalakllkalgargaavvldpktGevlalvggpdy.....
00484231   1/1  --------------------llllllllle.elaallkepdargaavvldpktGevlal...........
00508911   1/1  ----------------------dldlqltldaalqkalealpgvsgaavvldpktGevlal.........
00464381   1/1  --------------------------seklqqaleallkdlgap.gaavvvdvktGevlaynpdt.....
00469291   1/1  ---------------sldaklqkaleall........kelga.sgavvvidpktGevla...........
00481101   1/1  -----------------daelqkaalellpg...........lsgaavvldpktGevlalvggp......
00485111   1/1  ------------edlvltldaklqalaeel............gargavvvidpktGevla..........
00483051   1/1  -----------------dpklqkaleallke........lgargaavvidpktGevla............
00460141   1/1  -----------------dlelqkaleallke........pgasgaavvidpktGevla............
00464221   1/1  -------------------dlqsaldda....lqkllkepgar.gavvvidpktGevla...........
00533421   1/1  -------------------------------eklaallkelgasgaavvldlktgevla...........
00521441   1/1  ---------------------------adlqkaleallkepgasgaavvidlktGevlaynpdt......
00457911   1/1  -------------------------------llgllllllllllllllllllllllllmkklllllllll
00460081   1/1  --------------------------sdlqdaldallkelgasgaavvidlktgellarn..........
00474761   1/1  --------------------------lsLeqllealekelggrlgvvvidldtgevlaknade.......
00463431   1/1  -----------------------------eekleelekelggrlgvividldtgevlsynader......
00510551   1/1  -------------------------------------------fdagaggavvldlktGevlaaknad..
00466151   1/1  --------------------------------------------------dpdvgavgaivldldtgevl
00388111   1/1  --------------------------seleevlaallkklggrlgvavldldtgevlalna.........
00471751   1/1  -----------------------------------------lllaalaallpelgargavvldldtgevl


                         -         -         +         -         -         -         -:490
query           NRATAALRQPGSSFKVYTYSAAMEKGMKPDTLISDAPVTWRGWSPQNYGRSYAGKVTLQVALAKSYNTVP
00519641   1/1  dpngfnravqalrqpGStfKPfvvyaaALeeglitpatllddapitiggwtprnyldgkyhgpvtlreAL
00521191   1/1  pnlfvgfnravqalrqpGStfKpftaYaaaLeegliltpdtllddgpltlggglytprnwdggghgpvtl
00489851   1/1  fvggidlkpllnravqalrqpGStfKpftyaaaLeegvitpnttlddgpltlggrtirdwdpnydggghg
00477271   1/1  fvggissaplfnravqalrqpGStfKpftyaaaLeeglitpdtllddgpitiggwtprnydgkgllllhg
00492251   1/1  fggrdpdkplfnratqalrqpGStfKpftyaaaLeegvitpdttlddgpltlggrtirnwdpnydgrghg
00502871   1/1  fvggissalylallndlakpllnrat.glyepGStfKpltaaaaleegvitpnttlddpglllvggrtir
00464521   1/1  efnradq.rfppgStfKpftalaaLeagklsldttvtdspla..sytplnwg....gtvtlrealavSsN
00477331   1/1  ...adarfppgStfKpftalaaleegklsldtlvtdspla..gysplnwg....gtvtlrealaySsNta
00484231   1/1  nravadarrppgStfKpftalaaLeegkisldtlvtdsplalvgggpi......lgdltlrealaqSsNt
00508911   1/1  llnra.darfppgStfKpftalaaleegklsldtlvtdspla..sytplnwg....gtvtlrealavSsN
00464381   1/1  ........lfppaSttKlftalaalqlveeGklslddpvtdsplalvggkylppsnldlagggsitlrdl
00469291   1/1  ..rnadtrfppaSttKlftalaalqlveeGklslddpvtdsppalklg.gsnvdlrvggsitlrdlltha
00481101   1/1  ...aadarfppgStfKpftaaaaLeagklslddlvtdspl...glrpgnwd....gvvdllealavSsNt
00485111   1/1  .fnp..dtrfppaSttKlftaaaalelveeGklslddpvtdspsaylpgfp.nadlrvggsitlrdllth
00483051   1/1  nrnadtrfppaSttKlftaaaalqlveeGklslddpvtdsppalvggsp.nydlkpggsitlrdllthal
00460141   1/1  .rnadtrfppaSttKlftalaalqlveegklslddpvtdslpalvgg.psnydlkvggsitlrdllthal
00464221   1/1  ..rnadtrfppaSttKlftalaalelveeGklslddpvtdslpalvggspkndlr.vggsitlrdlltha
00533421   1/1  ..rnadarfppaStfKlftalaaleeegklslddtvtvsgpalvlggsitplnvgesitlrellraalay
00521441   1/1  .......rfppaStfKlftaaaalqlveegklslddtvtdsgpalvgggsirplnvggsitlrellrhal
00457911   1/1  llladalaallkelgakggavvidlktGellaknad.............trfppaStfKlftalaalelv
00460081   1/1  ...adtrfppaSttKlftalaalqlveleGkllddpvtvsgldllgagylpgsnvglagggsitlrdllt
00474761   1/1  ......rfppAStfKlltaaavleavdegklslddrvtiskedlvlgspvlellv.ggtltlrelleaal
00463431   1/1  .......fppAStfKlltalavleavdegk.ldekvtitkedlvagspvlellv.ggsltlrelleaall
00510551   1/1  ..........tlfppaSttKlftalaalqlveeGklslddpvtvskylpefgggsgitirlllghtsglr
00466151   1/1  asknaderfppASttKlmtaaaaleegklslddpvtvtellsdlapgspgskvflpaggsvtlrdlltaa
00388111   1/1  ....derfppaSttKlltaaavleavdegklslddkvtitesdlvp.gspvtellpgegitlrelleaal
00471751   1/1  asknadtrfppASttKlmtalavlelveegklslddpvtvslpalvlgsvlllpgslaflpagdsitlrd


                         *         -         -         -         -         +         -:560
query           VRLAKDVLGTQVIVDTAKAMGVATPLRSDKTIPLGTSEVTVLDQATAYAVFPADGMQSRRHGIEQVMDYE
00519641   1/1  akSlNvpavrllle.lgddldkvvdylkklGlgsplgiglslailggvevtplqlanayatlangGvyvk
00521191   1/1  realakSsNvpfvrlalkl.gldkladylrrfGlglktgidlpgeallslalGqglevtplqlaqayaal
00489851   1/1  pvtlrealakSsNvafvklalkl.gldklvdylrkfglgsktgidlpgeasgllplddwgdlaslalGqg
00477271   1/1  pvtlrealakSsNvafvklalkl.gpdklvdylrrfglglktgidlpgeasgllpswspldllslalGqg
00492251   1/1  pvtlrealakSsNvyfvrlalkl.gldklvdylrrfglglktgidlpgeasgllpsddwvdllslalGqg
00502871   1/1  nwdvtelggghgtvtlrealavSsNvyfvklalkl.gldklvdylkkfglgektgidlpgeasgllpdkl
00464521   1/1  taavalaerl.GvdamndyarklGlg.ntdlpgllslglggggltvTpldlarlyaalanggllvsplli
00477331   1/1  avalaerl.GvdamneyarklGlgntdlpgenpgglggggltvtpldlarayaalangglllepylikli
00484231   1/1  aavalaerl.GvdkmneyakklGlgntdlpgnlsgllgggltttpldlalayaalanggllvkpylikki
00508911   1/1  taavalaerl.GvdamneyarklGlgnttfdlnslglgqgsltvtpldlarlyaalanggllvkpslikl
00464381   1/1  lthalglSdNdaavalaerlgGpealaeflrrlglgapllglpgttfynssglgggllsTaldlarllaa
00469291   1/1  lgySdndaavllaerlgGpeslaeflrklgfg.ptglgmtntlflnasglgggllsTpldlarllaalan
00481101   1/1  aavalaerl.GvdamneyarklGlgnttfinlpgeapglnlaiglgsltvtpldlarlyaalanggllvk
00485111   1/1  alglSsNtaavllaellggadavneilkplGlgnttfvdlpgelnglglggggllsTpldlarllaalan
00483051   1/1  gySdNtaavllaerlgGleafaeylnelgfgptglgltdttfgnasglderllsTpldlarllaalang.
00460141   1/1  glSdNdaavllaerlaggadamneilkplGlgnttfvdlpgelngsgllgegllsTpldlarllaalang
00464221   1/1  lglSdNtaavalaerlaggpdavneparrlgysntgfdllglalgnvsglslgllsTpldlarllaalan
00533421   1/1  SdNtaavalaerlgGadamneyarklGlgnttfgldlpgensggllsrenlsTpldlarllaalang...
00521441   1/1  alSsNtaavllaerlgGadamneyakklGlgnttfidlpgelnglgllsrenltTpldlarllaal....
00457911   1/1  eeGk.lddtvtdspgalvlggp.nvdlrgggsitlrelltaalaySdNtaavaLaerlgGvdamneyarr
00460081   1/1  halglSdNtaavalaerlgGpealaaflrrlglgakplgmlpyeflgasglgrillsTaldlarllaala
00474761   1/1  lySdNtaanaLaerlgGpdavnafarelGltdtrldrpegllnealpgdgrnttTprdlalllaallngp
00463431   1/1  ySdNtaanlLaerlgGvdamnayakelGlkn.trldnpegllnealpgdgrntttprdlakllrallngg
00510551   1/1  dllrgalvySdNtaavllaellggsgksfaeamnerlrelGmtnttfvnpsGldrklwepellaalsggg
00466151   1/1  llySdNdaanlLaellgagseeavtglsfaeamndiakrlgltnttfvnpsglpdggntsTardlarllr
00388111   1/1  vySdNtaanlLaerlgGveavneyakslGlkntrldrlepelnaaglgdggnttTprdlarllrallng.
00471751   1/1  lltamlvySdNdaanlLaerlggsleafadamndiakplgmtnttfvnpsglgdggntsTardlarllra


                         -         -         -         *         -         -         -:630
query           GNVLYDFSHDEPPAKRVLSEEANSKMNQMLVTIPVMGTARRGALDNGIVSGGKTGTSQAYRDAWYVGFTG
00519641   1/1  pylikkivdsdgkvlyefk...pkvvrvispetaylvtdmLrgvvesgtgrrarslllllsllllgypva
00521191   1/1  angGvlvkphlikkivdadgkvl.eak...pvgervlspetaalvrdmlrgvvtsGtgrraalp.gypva
00489851   1/1  levtplqlaqayaalangGvlvkphlikkivdadgkvly..eakpevlervlspetaalvrdmlrgvvng
00477271   1/1  levtplqlaqayaaiangGvlvkphlikkivdadgkvly..eakpevlervlspetaalvrdmlrgvvtg
00492251   1/1  lsvtplqlaqayaalangGvlvkphlikkivdadgevly..elkpevlervlspetaalvrdmlrgvvts
00502871   1/1  wsegdlatlsigqgtllvtplqlaqayaalangGvlvkPhlvkkivdpdgn............krvisee
00464521   1/1  kkildalgrvl........................................ppgydvagKTGttqvgyag
00477331   1/1  tdldgnvll........................................pgyvvagKTGttngag..wfv
00484231   1/1  ldlngnvlln........................................gyvvagKTGttqvagdgyha
00508911   1/1  itdldgnv........................................lppgydvagKTGttqvagdnyl
00464381   1/1  lang...............................rllspetaalllsllrgvvtygtgnrlllpaggrv
00469291   1/1  g...............................rllspetaalllslligvvtggtgnrallpaggrvagK
00481101   1/1  pylikkivdanglvllp.......................................pgydvagKTGttqg
00485111   1/1  g...............................rvlspetaallldlllpvvvgdgtgrlllpp.gvdvag
00483051   1/1  ..............................rllspetaallldllrgvvtygtgnrallpaggpvagKtG
00460141   1/1  ...............................rllspetaellldllrgvvtngtgllaglpegvdvagKT
00464221   1/1  g...............................rvlspetaallldllrgvvtygtgnrlllppggpvagK
00533421   1/1  ............................rvlspetaallldllrgvvtggtgnrallpaggvvagKTGtt
00521441   1/1  ...........................lkgpvlspetaellldllrgvvtngtglllpl..ggrvagKTG
00457911   1/1  lGlgnttfvnlpgelsglapgdeglttTpldlarllaalanggll.........................
00460081   1/1  ng...............................rllspetaallldllrgvvtggtglrlllpdggrvag
00474761   1/1  ...............................llseisrallldllkgnvtggnrlrallpagwvvggKTG
00463431   1/1  ...............................llspesrsllldllkgnvtggnrlraglpkggvvggKtG
00510551   1/1  glysTardlarllrallngg..............................pllspetaallltlll..vv
00466151   1/1  allnggllpeilrtllltllvantt......................gdllelvvraglnrlllpygg.v
00388111   1/1  ..............................dllspesraqlldllkgnvtgdnrlraglpygwvvggKtG
00471751   1/1  llnggpllsplssallltll...............................ggtltgtnrllaglpagv.


                         -         +         -         -         -         -         *:700
query           NYTTAVWFGNDEFTPMNNMTGGALPAMTYKRLMDYAHQGMELRPIPGIQNLLPTGARPQPSAQVAAASAT
00519641   1/1  gKTGTtndyrdawfvGytpryvvavwvGnddneplggltgg-----------------------------
00521191   1/1  gKTGTaqvvllggggklllselgrrdawfvGyapdpviavwvgvddgkpglgltggsvaap---------
00489851   1/1  slslelltggtgrrlalvlgypvagKTGTaqvvdlglggyll----------------------------
00477271   1/1  sllllllsgGtgrrlaavlgypvagKTGTaqvvdlgaggyllgnglrdaw--------------------
00492251   1/1  grllllllsGtgrrlaavlgypvagKTGTaqvvdlvaggylllnglrdawfvGyaP--------------
00502871   1/1  tadlvrdmlrgvvtsGtgraaavp.gypvaGKTGTaevvvlggyngry----------------------
00464521   1/1  daadawfvgyapadgprlvvavlvgnpdgs......gga-------------------------------
00477331   1/1  gyaptdgprlavavlvddpgplr...ggsvaapiareilea-----------------------------
00484231   1/1  wfvgfapadnprlvvavlvgndd......ltggsvaapia------------------------------
00508911   1/1  awfvgyapaddprlvvavlvgndd.......tggsvaapia-----------------------------
00464381   1/1  agKtGttqvvlGlagvawfvgyappadgprlavvvlvndpgp.raa------------------------
00469291   1/1  tGttlnggrslvgfapradgpviavvvgvddpga.-----------------------------------
00481101   1/1  agdnryhawfvgyalpadgprvvvvvlvdnpggdrltg--------------------------------
00485111   1/1  KtGttnlggrslvgfapdladgprlavvvlgndpgagaaaraaiaa------------------------
00483051   1/1  ttneggrslvgfapadggrviavvvgvndpgg.raaea--------------------------------
00460141   1/1  Gttqvagvawfvgyapapdgprlivvvlvdd.pgggr---------------------------------
00464221   1/1  tGttndagdawfvgyalpadgprlavvvlvndp.ggg---------------------------------
00533421   1/1  n.vggawfvgyapladgprlivvvlvddpg.ggraaa---------------------------------
00521441   1/1  ttlrg.gawfvgyapdadgprlvvvvlvgg.....psggag-----------------------------
00457911   1/1  ..--------------------------------------------------------------------
00460081   1/1  KTGttqv.ggawfvgyapaddgrrlvvvvlgndpgag---------------------------------
00474761   1/1  ttdyagrndvgivtlpggrlivvvvltdgskarae.----------------------------------
00463431   1/1  ttdaagvrndaalvgtpnrdgpyviavllngldk.-----------------------------------
00510551   1/1  lygtgrlllraglpldgvvggKtGttggag.a--------------------------------------
00466151   1/1  vggKtGttdgagndlaivappdgrrli-------------------------------------------
00388111   1/1  ttdyggr..ndvgivwppngrplivvvltngpdnda.......---------------------------
00471751   1/1  vggKtGttdgagndlgivatrdgrrlivvv----------------------------------------


                         -         -         -         -         +         -         -:770
query           TAPAMPALTRPRSLSAEATRVIRSIAKTMKEAPPLAVTTQKVAEATIRDGRDEAGRR-------------
00519641   1/1  ----------------------------------------------------------------------
00521191   1/1  ----------------------------------------------------------------------
00489851   1/1  ----------------------------------------------------------------------
00477271   1/1  ----------------------------------------------------------------------
00492251   1/1  ----------------------------------------------------------------------
00502871   1/1  ----------------------------------------------------------------------
00464521   1/1  ----------------------------------------------------------------------
00477331   1/1  ----------------------------------------------------------------------
00484231   1/1  ----------------------------------------------------------------------
00508911   1/1  ----------------------------------------------------------------------
00464381   1/1  ----------------------------------------------------------------------
00469291   1/1  ----------------------------------------------------------------------
00481101   1/1  ----------------------------------------------------------------------
00485111   1/1  ----------------------------------------------------------------------
00483051   1/1  ----------------------------------------------------------------------
00460141   1/1  ----------------------------------------------------------------------
00464221   1/1  ----------------------------------------------------------------------
00533421   1/1  ----------------------------------------------------------------------
00521441   1/1  ----------------------------------------------------------------------
00457911   1/1  ----------------------------------------------------------------------
00460081   1/1  ----------------------------------------------------------------------
00474761   1/1  ----------------------------------------------------------------------
00463431   1/1  ----------------------------------------------------------------------
00510551   1/1  ----------------------------------------------------------------------
00466151   1/1  ----------------------------------------------------------------------
00388111   1/1  ----------------------------------------------------------------------
00471751   1/1  ----------------------------------------------------------------------