[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for atum0:AAK86987.1


[Show Plain Result]

## Summary of Sequence Search
   1::863
  22::863 4.3e-230 38.0% 0035949 00359491 1/1   NA polymerases                          
   1::863


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MIELDTTNELFLAAHGCLPTEHEAWEKQIALEEEMRSAGIARFEKGLEKNREKNAEASNLSSRRMIIHAH
00359491   1/1  ---------------------llklslyellvlllllnelldnkkelllerqlllEtellelalerfrkl


                         -         -         *         -         -         -         -:140
query           AQVIAGLEAFLAEASSGKAGKKHTAVAYLKDADLDVVAHLTLRNLFDYVSMRMKLTPLSIRLAAMVEDEL
00359491   1/1  lenllelglisdllslkklllewleallelieellellksk.kglrlillpylllldeellavitllvll


                         +         -         -         -         -         *         -:210
query           FFNAFKGHDKDAYEYARKKISEQTHNAVHQKRAMTKHAKHKGAEWQDWSQDVKAKVGLKLIEIAVEQTGL
00359491   1/1  nllalgggvsltqlalslgkaveqeyrillllklelkllkkllkkllnkelglllkkllvlvleldlllk


                         -         -         -         +         -         -         -:280
query           FEIVRQSEGAHNTNIYVVATKETLDWLATENSRLAPLSPVYLPTLVPPRPWTSPFRGGYWSGRVRNLRLI
00359491   1/1  lllleedlelwdlevllklGslLlelliesdllpaflhvfklvngkklgvlklsplllellaklalllll


                         -         *         -         -         -         -         +:350
query           KTGNRQYLMDLESVDMPKVYHSINAMQNTAWSINHRVYEVMASLWDNQSTLACIPQADDMPLPEKPMWLA
00359491   1/1  lsplylPmlvpPkpWtsllsGGyllnklrllrllvtqslyllraleigdldkvydalnvLgstpwkINkk


                         -         -         -         -         *         -         -:420
query           PEMKREDMSPEQLEEFSRWKSERTTIYEANARAVSKRLAFSRMLGVATRFKDEEEFYFPHQMDFRGRVYA
00359491   1/1  lLdvilevwnsgllildipplvdeldlplllkdil............ldleelkewklelkelkkellel


                         -         -         +         -         -         -         -:490
query           VPLFLNPQGDDASHGLLQFANSVPITNEEGADWLAIHGAGLWGVDKCSMNERVEWVMANQREILASAENP
00359491   1/1  islrcdelyilelArafkdeeefYfPhnlDFRGRvYpls.ylnhlgsDlarsLLlFaegkpl.geegldw


                         *         -         -         -         -         +         -:560
query           YDNRFWLTAEKPWQALAFCFEWQGYVAEGFAFHSHLPVQMDGTCNGLQNFSAMLLDEIGGAAVNLVPSDK
00359491   1/1  LkihlAnlygldKlsleerlewveenleeildsaenPldgkwwlkAdePfqfLAaclelanalesgdpfi


                         -         -         -         *         -         -         -:630
query           PNDIYATVASVLIAKLRDIAAACPEDTTTKEVKDKETKENKTIVVESDGSMARKWLAYGITRKVTKRPVM
00359491   1/1  shlPvhqDGsCnGlQhyaaLlrDelgAkaVNLlpsdkPqDvYsfvaelvieyleddalkglelav.kllt


                         -         +         -         -         -         -         *:700
query           TLAYGASEFGFREQVFTDTVTPWKQAAGEAFPFEGTGFAAASFLGLLIWDCVGEVVVAAAGAMDWLQKVA
00359491   1/1  dnetgellelvveedkallakllllkitRkvvKqtvMTlvYGvtfygareqilerlkeia........ii


                         -         -         -         -         +         -         -:770
query           KIAAKESLPVIWNTPAGLKVMQEYTTSEQKRLELTFQKVRLQLSIDVASKKIDKRKQGSGISPNWVHSMD
00359491   1/1  lgddllfellveaalylaklildalgelfpgareimdwLnelakliakllklelleellklnlpviWttP


                         -         -         *         -         -         -         -:840
query           AAHMQLTVSRCHDEGIRSFSLIHDSYGTHAGNAWAMAQFLREEFVKMYGDHDVLAEFGREITAMLPEGTQ
00359491   1/1  lGlpvvQpYrklkkkkvktslqgvtrrklivlsldtdkvdkrkqktafpPNfiHslDAshlmltalaclk


                         +         -         -         -         -         *         -:910
query           LPPLPEKGSLDLSQVLESAFFFA-----------------------------------------------
00359491   1/1  lggilsfaaVHDsfwthandvdl-----------------------------------------------