[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for atum0:AAK87067.1


[Show Plain Result]

## Summary of Sequence Search
   1::396
  18::396 1.4e-135 44.5% 0052775 00527751 1/1   Nqo4-like                               
   9::396 2.5e-117 40.9% 0045288 00452881 1/1   Nqo4-like                               
   1::396 1.9e-116 38.9% 0036736 00367361 1/1   Nqo4-like                               
   5::396 2.5e-109 37.2% 0038381 00383811 1/1   Nqo4-like                               
   2::396 3.8e-106 35.1% 0037746 00377461 1/1   Nqo4-like                               
   9::396  5.1e-97 34.5% 0035906 00359061 1/1   Nqo4-like                               
   1::396


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTEHNVRNFTINFGPEHPSAHGVLRLVLELDGEIVERVDPHIGLLHRGTEKLIETKTYLQAVPYFDRLDY
00527751   1/1  -----------------prieGhlrlrleldgevvvdaephigylhRGfEkllegrdyldalpltdRicg
00452881   1/1  --------krivigPvtr.ieGhlrlrleldggvVvdadl.igylhRgfEkllegrdprdalplteRicg
00367361   1/1  msk.gegvlrivigPvtri.eGhlrlevevdggvVvdadlh.gtlhRgfEkllegrdpedalplveRicg
00383811   1/1  ----gdmvkrivigPvtr.ieGhlrlrlevdggvVvdadl.lgylhRGfEkllegrdpedalplveRicg
00377461   1/1  -leegdmvkrivigPvtr.ieGhlrirlevdggvVvdarl.lgtlhRGfEkllegrdpedalalveRicg
00359061   1/1  --------krivigPvtr.ieGhlrielevdggvVvdarlh.gtlhRGfEkllegrdpedalalveRicg


                         -         -         *         -         -         -         -:140
query           VAPMNQEHAFALAVEKLLGLEIPMRGQLIRVLYSEIGRILSHIMNVTTQAMDVGAMTPPVWGFEEREKLM
00527751   1/1  icsvahalayalAvEkllgievPerAqllRvllleleriasHllhlgllalddgaltlflyalrlrekil
00452881   1/1  icpvahalAsvrAvEkalgievPerAeliRnlllelerihsHllhfyhLaapDfvlvvdalkadpakanv
00367361   1/1  icpvahalAsvrAvEkalgievPeraqllRnlllelerihsHllhfylLaapDfvlvvdalpadrnvage
00383811   1/1  icsvahalAsvrAvEkalgievPeraellRnlllelerihshllhfylLaapDfldvvlaldadpakrna
00377461   1/1  icsvahalAsarAvEkalgievPpraellRnlllelerihsHllhfylLaapDfvdvvdalpadrnvagl
00359061   1/1  icpvahalAsvrAvEkalgievperaqllRnlllelerihsHllhfyllaapDfvlvvdalpadrnvavl


                         +         -         -         -         -         *         -:210
query           VFYERACGARMHSAYVRPGGVHQDLPPELVDDIGKWCDPFLTVLDNIEGLLTDNRIYKQRNVDIGVVSLE
00527751   1/1  eilellgGkrphpsyirpGGvardlpaellekllalldellkfleeylellldngifldrlvgvgvlsae
00452881   1/1  lglalsdlllspgllaavqerlkalvesgqlgifanayllgghpaykltlaldlgaltlylealrlreli
00367361   1/1  laaslsdllssegelaavqgklkklvesgqlgpfanaywllghpayklalaldlgaltlylealrlrell
00383811   1/1  lalaladlpssageladvqdklkglvesgqlgifanaywllghpayklapaldlgaltlylyalrlrell
00377461   1/1  laaspslaaplssegelrdvqdklkglvesgqlgifanaywllghpaykltpeldlgalshylealrlre
00359061   1/1  aalkgfvlsgqlgpeldlgalslylealrlrelgleiiellgGkrphpsalvvGGvrrdlseealeella


                         -         -         -         +         -         -         -:280
query           DAFAWGFTGVMVRGSGAAWDLRRSQPYECYSDLEFDIPVGKNGDCYDRYLIRMQEMRESVKIMKQCVDRL
00527751   1/1  daldlgltgpvlrasgvdydlrkiepyvayswldfdvpvgdegdvyarllvrryemreslplarqaldkl
00452881   1/1  leiiellgGkrphpsylvpGGvardlpldeelldellalldellefveevllldlllildeyeelllgnr
00367361   1/1  leiiellgGkrphpsylvpGGvardlnlpeerldellalldellefleelldfdlllllpiykdrlvgvg
00383811   1/1  leiiellgGkrphpsylvpGGvardlsldeealdellalldellefleellepdlllllpiyldrlvgvg
00377461   1/1  lgleiiellgGkrphpsylvvGGvardlslneerldellalldellefleelleldllllnrilkdrlvg
00359061   1/1  lldellefleelvlllllallsllldllelglglglllsygelplllggldllflggvildgdldlydga


                         -         *         -         -         -         -         +:350
query           SGKHRIGPVSSLDGKVVPPKRGEMKRSMEALIHHFKLYTEGYHVPAGEVYAAVEAPKGEFGVYVVADGSN
00527751   1/1  p....ggpsvlgrhlarlielllllelmeellddlklvtpgllppagegvglvEapRGelghylvidgng
00452881   1/1  ilnfrtlgvgvvdaegalelgltgpvlrasgllevdaldlrkieeyvaydwldddaglhPwdgvtePdyt
00367361   1/1  vlnalsyglvelaanlgltgpvlrasgvvldlrldepyevdpelieelvdhswylgealhpwsgltlPyy
00383811   1/1  vlnalsygefpaldlglvgpalrasgvaydlrkdvpyldydeldeyvghswyedddglhpfdgltlpdyt
00377461   1/1  vgvgnllalgalplgltgpvlragslllysGvlrdlrldgpylvddekieelvthswyeddveplhPwdg
00359061   1/1  liledvahswyeddnpillhrlegvgvliaelavkyswlkaPrykggpyevGplaRllvagasgvpldvr


                         -         -         -         -         *         -         -:420
query           KPYRCKIRAPGYAHLQAMDFLCKGHQLADVTAVLGSLDIVFGEVDR------------------------
00527751   1/1  kiyrykirvPtfwnlgaleaalrgtlladvpliirSfDpclscadr------------------------
00452881   1/1  llelvekyswlkaPrykggpyevGPlArllvagalltplakellee------------------------
00367361   1/1  kaldeedgyswakaPrydgkpyevGPlARllvagalgtplakelle------------------------
00383811   1/1  ileevekyswlkaPrykggpyevGPlArllvayalgtplakellee------------------------
00377461   1/1  eteplytlgelvekyswakaPrykggpyevGPlArllvagalgtpl------------------------
00359061   1/1  llepyllydeldfevpvlalgdvlarllaRllElleslelieqlld------------------------