[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for atum0:AAK87170.1


[Show Plain Result]

## Summary of Sequence Search
   1::247
   5::232  6.8e-88 53.1% 0039684 00396841 1/1   aprenyl diphosphate synthase            
   3::231    3e-87 55.0% 0037424 00374241 1/1   aprenyl diphosphate synthase            
   1::247


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPTTTRSSIPEHVAIIMDGNGRWAKQRGLPRVMGHRRGVEAVRETVRAAGDCGISYLTLFAFSSENWRRP
00396841   1/1  ----klgklPkhvAiimDGngRwAkkrglerllghkagveallelvewclelgikvltlYafstenwkrp
00374241   1/1  --vlklgklPkhvAiimDGNgRwAkkrglerlegheagvealleivewclelgikyltlYafstenwkrp


                         -         -         *         -         -         -         -:140
query           ESEVSDLMGLLKAFIRRDLAELHRENVRVRIIGDRQGLKTDIRSLLEEAEQMTAGNTKLTLVIAFNYGSR
00396841   1/1  keevsflmdllldaleelldlllklgvrlrvigdlsllpeellellekaeeltknntgltlnlavnyggr
00374241   1/1  keevsflmklllelleellelllkngvrlrvigdlsllpedllelleeaeeltanntgltlnlalnyggr


                         +         -         -         -         -         *         -:210
query           DEITRATASIARDVAEGRLSADAITPEMISSRLDTSGMPDPDLIIRTSGEERLSNFLLWQAAYSEFLFVP
00396841   1/1  deivdavkklaelvaagklspedideelldshLytsvlpdpDLlirtsgelrlsnFllWqiayselyftd
00374241   1/1  deivdavkklaeevaegklspediteelldslLytsglpdpDLlirtggelrlsnFllWqiaytelyftd


                         -         -         -         +         -         -         -:280
query           EYWPDFDRQRFFSAIEQYATRDRRFGALAEQVAVAGA---------------------------------
00396841   1/1  vlWpdfdlldllralldyqkre------------------------------------------------
00374241   1/1  vlWpdfdlldllralldyqrr-------------------------------------------------