[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for atum0:AAK87211.2


[Show Plain Result]

## Summary of Sequence Search
   1::306
  16::301  1.3e-41 23.8% 0050099 00500991 1/1   inked oxidoreductase                    
  26::301  2.1e-38 24.5% 0045882 00458821 1/1   inked oxidoreductase                    
   1::306


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MGWSSFWDNSGADGDVVRSSNILAGWSIEVMPRTAAKIDDFRNILPDGTRVYIAHIDGTPIADMVSTAKR
00500991   1/1  ---------------lskllellasgkfvisfElfPPktldgveklleaaerlaglgpdfvsvtdgaggs
00458821   1/1  -------------------------gefvisfElfPpktldgveklleaaerlaglgpdfvsvtdgaggs


                         -         -         *         -         -         -         -:140
query           LHDEGFPVMPHLPARGISGKNELEDWLKRYQGEAGVTQALLLGGGQKQPAGSFSSSIDMIETGLFDKMGF
00500991   1/1  trestlalaalllelglevvphltcrdr.nreelqsillgaa.alGirniLaLrGDppkggdlpeappvg
00458821   1/1  trestlalaallqdelglevvphltcrdr.nreelqsillgaa.alGirnilaLrGDppsggdggfldav


                         +         -         -         -         -         *         -:210
query           THLHLAGHPEGNRDIDSDGSSRGVDQALLWKQDFASRTDARLALTTQFAFEAKVVIEWAKRIGNMGVTIP
00500991   1/1  fldavdLvelirklnggdfligvAayPeghpea...psleadldrlkrKvdaGAdf.....iiTQlffda
00458821   1/1  dLve..likklndffigvAayPeghpea...psleadldrlkrKvda....GAdf.iiTQlffdaelflr


                         -         -         -         +         -         -         -:280
query           VHVGIAGPTKLQTLIKFAIACGVGPSLKVLQKRALDLSRLFVPYEPTDFIAELIDHKAANPDSLIEHVHI
00500991   1/1  eaflrfldrlraagidvpiipgimpltslkqllrlaelcgvsiPaellkrleaakddleavrllgieiaa
00458821   1/1  fldrlraagidvpiipgimPitslkqllrlaelcgvsiPdellkrlegakddleavrlvgieiaaeliee


                         -         *         -         -         -         -         +:350
query           FPLGGIKPSAEWMKKHASTGTLANVA--------------------------------------------
00500991   1/1  elieellel.......gvpgl-------------------------------------------------
00458821   1/1  llelg.......vpglhlytl-------------------------------------------------