[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for atum0:AAK87429.2


[Show Plain Result]

## Summary of Sequence Search
   1::228
  22::225  1.3e-51 38.5% 0035601 00356011 1/1   ependent nitroreductase-like            
  21::225  2.6e-49 37.7% 0037401 00374011 1/1   ependent nitroreductase-like            
  12::230  1.6e-46 35.0% 0052748 00527481 1/1   ependent nitroreductase-like            
  21::226  3.2e-45 34.1% 0051556 00515561 1/1   ependent nitroreductase-like            
  22::223  4.7e-44 36.7% 0051432 00514321 1/1   ependent nitroreductase-like            
  21::223  1.6e-41 35.5% 0044736 00447361 1/1   ependent nitroreductase-like            
  22::223  3.4e-40 35.5% 0051924 00519241 1/1   ependent nitroreductase-like            
  24::223  9.5e-37 29.1% 0036576 00365761 1/1   ependent nitroreductase-like            
  24::221  2.3e-35 29.4% 0041335 00413351 1/1   ependent nitroreductase-like            
  24::223  4.9e-35 30.9% 0041494 00414941 1/1   ependent nitroreductase-like            
  24::203  2.4e-25 39.3% 0044848 00448481 1/1   ependent nitroreductase-like            
  24::205  1.2e-20 26.5% 0053102 00531021 1/1   ependent nitroreductase-like            
   1::228


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MQANPFDHALSPARPFSGAEREAIYRAIETRRDVRDQFLPDPLPEELVERLLKAAHSAPSVGFMQPWNFT
00356011   1/1  ---------------------mdllelilsRrSvR.kFtdepvpdevleelleaarlAPssgnlqpwrfv
00374011   1/1  --------------------mmellelilsRrSvR.kFtdepvpeevleelleaArlAPSsgnlqpwrfi
00527481   1/1  -----------lllllllllmmdllelllsRrSvra.fddepvpeevleeileaArlAPSsgnlqpwrfv
00515561   1/1  --------------------mmdlleliksRrSvRk.FddepvsdevleeileaarlAPSsgnlQpwrfv
00514321   1/1  ---------------------lllmmdlleliksRrSvRk.fkdelpvsdevleeileaarlAPSsgnlq
00447361   1/1  --------------------mmdlleliksRrsvRa.fdtdkpvpdevleelleaarlAPSsgnlqpwrf
00519241   1/1  ---------------------mdllellksRrSvrk.fddepvsdevleeileaarlAPSsgnlqpwrfv
00365761   1/1  -----------------------mdvlelilsRrsvRafdpdkpisdedleeileaarlAPSsvnlqpwr
00413351   1/1  -----------------------dvleailsRrsvRafdpdkpvsdedleeileaarlAPSsvnlQpwrf
00414941   1/1  -----------------------pmmdvleailsRrsvR.kFdpkpipdedleeileaarlAPSslnlQp
00448481   1/1  -----------------------dvleaiksRrSvRk.Fldkpvpkelleeilea..........qPWrf
00531021   1/1  -----------------------mdflellkkRrSvr.afdpdlkisdeelielileaaklAPSafNsQp


                         -         -         *         -         -         -         -:140
query           LVTDGGVRQAAWVAFSRANEEAAAMFEGEKQALYRSLKLEGIRKAPLSICVTCDPTRGGKVVLGRTHNPR
00356011   1/1  vvtdpelreklaell.....................gnqeyvadapvlivvvadlerlaklpellqlgel
00374011   1/1  vvtdpelreklaela.....................lgqeyladapvllvvvadldrlakllellglgel
00527481   1/1  vvtrdgelkeklaellae...................gnqeklldapvlivvladldlsek..lpellll
00515561   1/1  vvtdpelkeklaela.....................gnqpyvadapvlivvvadldrvekllelfglaaa
00514321   1/1  pwrfvvvtdeelkkllaela.....eallalvpeeaflatelnqegfldApvlivvfadldlveklpelf
00447361   1/1  vvvedpelkeklaellaeal................egnqeqlldapvlivvladtdrleelvellldrr
00519241   1/1  vvtdpelreklaeal.....................gnqekvldapvlivvladldrarklplleqlyga
00365761   1/1  fvvvrseelkeklaelaagalafnqpqvldasalvvvladtdltelllelyldallelgrlldeeraall
00413351   1/1  vvvrdeelkeklaeaaagalafnqpqvldasvlivvladtdlteellelvldllvelgrtldeeleaavl
00414941   1/1  wrfvvvedeelkeklaelafnqpqvldasalivfladldralaildlvllllladelllalllallglfl
00448481   1/1  vvvtgeelkeklaall.....................lgnkqlfgApalivvvadkd.............
00531021   1/1  wrfvvvlgeehkklwdivaenlkkvvpasavfavtgdllalfkagygtilffedgavvealqelfplyad


                         +         -         -         -         -         *         -:210
query           TDVYSTVCAIQNLWLAARAEGIGVGWVSIFHDSDVRAILDIPEHIEIVAWLCLGRVDALYTEPELAVKGW
00356011   1/1  elllvalldagiaaqnlllaAralGLgtcwiggflnddeavrelLglpedevpvaglalGypa.....ee
00374011   1/1  tlllyalvdagiaaqnlllaAealGLgtcwiggfrndpeavrelLglpedvvpvaglalGypaeeppvkp
00527481   1/1  lealldagiaaqnlllaAralGlgtcwiggfdpeavrellglpegerpvallalGypdeeaplpellreg
00515561   1/1  allgelelllwalvdagiaaqnlllaAaalGLgtcpiggfrndpeavrelLglpegykpvallalGypde
00514321   1/1  plgaellplwalldagiaaqnlllaAralGlgtcwigylgfddeavrellglpedlklvallalGypdee
00447361   1/1  vevglllyealgnlllflapvlllllgdkvladwalldaglaaqnlllaAralGlgtcpiggfdpeavre
00519241   1/1  lgifeedlealleqllrnfllfgaellllwalldagiaaqnlllaAaalGlgtcpiggfdpeavrellgl
00365761   1/1  lllrgffaallllsladlrdwalrdaglaagnlmlaAralGldtcpmggfdpekvrelLglpedgyvpvv
00413351   1/1  lllaafaellllllrdlrdwaardaglaaqnlmlaAralGldtcpmggfdaekvrelLglpedgyvpvvl
00414941   1/1  algeetlldwalldaylaaqnlllaAralGlgtcpiggfdpekvrelLglpegyvpvvllalGypa...e
00448481   1/1  eyalldtgialqnlmLaAtalGLgtcwiggfddkdlvlilviglprlaeaektrrplfeelvr-------
00531021   1/1  nfpvwseassgmalaamwlalaaeglGaslqhynpliddavaellniPedwklvallpfGypeep-----


                         -         -         -         +         -         -         -:280
query           RQRVPLEELVFRNRWGGR----------------------------------------------------
00356011   1/1  ...pppkprlpleev-------------------------------------------------------
00374011   1/1  ........rlpleev-------------------------------------------------------
00527481   1/1  wlpkpRlpleevvtflgfgd--------------------------------------------------
00515561   1/1  epp........pkpRl------------------------------------------------------
00514321   1/1  pp........pkp---------------------------------------------------------
00447361   1/1  llgldpegyrpva---------------------------------------------------------
00519241   1/1  pegerpvallalG---------------------------------------------------------
00365761   1/1  lvalGyrd....e---------------------------------------------------------
00413351   1/1  valGyrd....-----------------------------------------------------------
00414941   1/1  epl.....pkpRl---------------------------------------------------------
00448481   1/1  ----------------------------------------------------------------------
00531021   1/1  ----------------------------------------------------------------------