[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for atum0:AAK87597.2


[Show Plain Result]

## Summary of Sequence Search
   1::417
   5::327  2.1e-98 43.8% 0039570 00395701 1/1   otidylyl transferase                    
   1::333  4.7e-86 38.2% 0049118 00491181 1/1   otidylyl transferase                    
   6::323  3.6e-78 31.9% 0053312 00533121 1/1   otidylyl transferase                    
  36::358  8.3e-74 35.6% 0046259 00462591 1/1   otidylyl transferase                    
   3::338  3.1e-71 31.2% 0047114 00471141 1/1   otidylyl transferase                    
   7::317  3.8e-60 33.2% 0039322 00393221 1/1   otidylyl transferase                    
   6::321  4.5e-58 29.3% 0048275 00482751 1/1   otidylyl transferase                    
 308::417    2e-18 38.4% 0039540 00395401 1/1   -L RNA-binding motif                    
 334::418  1.9e-17 38.8% 0047115 00471151 1/1   -L RNA-binding motif                    
 326::396  6.9e-06 31.3% 0042206 00422061 1/1   -L RNA-binding motif                    
   1::417


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSRFKSDFLRTLDERGFIHQISDEAGLDELFAKETVTAYIGYDPTASSLHVGHLTQIMMLHWMQKTGHQP
00395701   1/1  ----tvelllelierglieqltdeelldkllngkpvrlytgfdPtagslHlGhlvpldklrrfqraghev
00491181   1/1  ellvtPweveglsdegvdydklieefgielideellerlelltleellellrRglvfevtdedellelle
00533121   1/1  -----vdlllelllrglietltdeeelfkllekgpvrvycGidPTgdslHlGhlraldvlrylqdagydv
00462591   1/1  -----------------------------------PlrvytGfdPT.gslHlGhlvgalklrrllqaghe
00471141   1/1  --gmsvdellelllrglyntltdekelfklleggpvrvycGidPTgdslHlGhlvtadvlrrflragydv
00393221   1/1  ------kenlelierglielwreee.lfellekkkvrvytgpdPt.gslHlGhlrgaikldvlaragydv
00482751   1/1  -----gmslllklllirgllneltdekelfellegkpvrvycGptPtgp.lHlGhartalvlarflraGy
00395401   1/1  ----------------------------------------------------------------------
00471151   1/1  ----------------------------------------------------------------------
00422061   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           ISLMGGGTGMVGDPSFKEEARKLMTIDMIEDNITSLKHVFANYLDYDRAENPALMINNADWLRGLNYLEF
00395701   1/1  lvliGdatgrigDpdgkiieralltlelvdenieyikkllakgldy.dgpekvtivnnsdwlsklnlidf
00491181   1/1  egkplrvytGfdPTgdslHlGhlvgalklrrllqalgheviiliaDlhaligdp.........ldleeir
00533121   1/1  illiadltdliddkilkraerlgenlldpeelaenieeyaadllalg.ldp..ekvtiflnsdvlshlel
00462591   1/1  villiaDldal..........rvlldpeeirenileiiaqllalgldpd....ktvifnqsdw...leyl
00471141   1/1  illigDltgliddpigkratrvgldpeelrenaieailedlkalgidp..gkayifnnsdylpvlsfldy
00393221   1/1  lfligDlhgliidpa.........pkelvrenieeikeqllalgldpek....wtifrqsdw...geyie
00482751   1/1  dvlfligDahgliidpage...lg.lprelveenaaailedlkalgidpd....kfiitaqseileivel
00395401   1/1  ----------------------------------------------------------------------
00471151   1/1  ----------------------------------------------------------------------
00422061   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           LRDVGRHFSVNRMLSFDSVKTRLDREQSLSFLEFNYMILQAYDFVELNQRTGCRLQMGGSDQWGNIINGI
00395701   1/1  lrdlgkhvsvnrmlarddfalrl..edgislgeflYpllqayDflhlecgygvdlqigGsDqfpnillgr
00491181   1/1  enieeliaqllalgldpdk....tfivnnsdwlgklswylsflldlgrlfrvnqmke......rfglekg
00533121   1/1  adllrglarvgtlnrmldpkdfvlrk..adgiseglftypllqaaDilhlylgegadivpgGsDqlphhe
00462591   1/1  ellwdlgklttvgrllrkdsvkdrlelgdpislgeftYpllqaaDilll....gadlvpgGeDQlphiel
00471141   1/1  lr.lsglvsvnrllrgddvkdrlekdlpisfglftYpllqaadilhl....gadivlgGkDqfphhelgr
00393221   1/1  llldlgklttvgellrrddvkdrw..dssisfgllgYpllqaadilll....gvdivpgGkDqwphhelg
00482751   1/1  iekLlekglayealnrmvyfddvvdvwfdg..wsiglf.ypllqaadilll....gadivlgGkDqffhl
00395401   1/1  ----------------------------------------------------------------------
00471151   1/1  ----------------------------------------------------------------------
00422061   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           DLGHRMGTPQLYALTSPLLTTSSGAKMGKSASGAVWLNKDLLPVYDFWQYWRNTEDADVVRFAKLFTTLP
00395701   1/1  dllrallglpkpvglttplllgldGeKMSKSlgnaiwlddllksiykkiqkalnvydadvlrylllftfl
00491181   1/1  islgefsYpllqaaDilhlelsallkadgdlldlvpgGsDQrphielgrdlarrlnlpepyilttplltg
00533121   1/1  leralaralgkkfpvywlhlplltgldGeKMSKSlgnaitlddektipekirkallssgdrdvlnllkll
00462591   1/1  grdlarrlgalykppfvlhlplltgllarllgldgpvkKMSKSlgnflsaifllddpeeirkkilkaytd
00471141   1/1  alaralggkppyvlhhplllgldGteKMSKSlgnaitlddllekigp.kilryy....dallsthyrlpl
00393221   1/1  reiar....pfpvllthplllgldGveKMSKSkgnvitlddlleeiakkikkaftdprevygadalryfl
00482751   1/1  elgralaralglpfpevlthplllgldGeKMSKSlgnsvitlldlleeygadilryfllsgnyrdddvld
00395401   1/1  ----------------------------------------------------------------------
00471151   1/1  ----------------------------------------------------------------------
00422061   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           MDEIARIATLGGSEINEAKKILATEVTAILHGRAAAEEAAETARKTFEEGALAENLPSIEVPTSELDAGV
00395701   1/1  dleeieeleeeyrkglnprelkkllaeeltellhgieearealeatk-----------------------
00491181   1/1  ldgpteKMSKSlgnsaIfllddpeeikkkilkfaftdpnpllefsrnllgdpd-----------------
00533121   1/1  lflaleelerlraeylggkgpgeakkllaeeltellhpidear---------------------------
00462591   1/1  pleliqfdln.gdpeverllklltfldleeieeleadygglgpgdlKkalaeeltellhpirearaalee
00471141   1/1  dfsleellelldlllrlknarlaqlrlayelgklvhgelkaalaellnellaplrell------------
00393221   1/1  lsglpdkdvvfllelltelsldeleelenayrsgeln---------------------------------
00482751   1/1  fselilflaldllnklrnalrfgplllealeelaeeytsgv-----------------------------
00395401   1/1  ---------------------------alfhgglaelqaeelfe.......llddlpevel....lllei
00471151   1/1  -----------------------------------------------------dglPdvllellllleeg
00422061   1/1  ---------------------------------------------rllkgelpddllevels....deyi


                         -         -         -         -         *         -         -:420
query           GVLSLIVRAGLASSNGEARRHVQGGAVKINEQGVSDERQIIGTGEVTGDGVIKLSVGKKKHVLVRPA---
00395701   1/1  ----------------------------------------------------------------------
00491181   1/1  ----------------------------------------------------------------------
00533121   1/1  ----------------------------------------------------------------------
00462591   1/1  dk.lllei--------------------------------------------------------------
00471141   1/1  ----------------------------------------------------------------------
00393221   1/1  ----------------------------------------------------------------------
00482751   1/1  ----------------------------------------------------------------------
00395401   1/1  rLdklLvraglakSrreArrliqagaVlvngekvtdpgykvdpgdlievdglllrvgkkkflllllk---
00471151   1/1  irldklLvraglakSrsearrlikqggvrvngevvtdpglkv.....llgdvivlqvGkkkfalvvlk--
00422061   1/1  rLdqlLklaglaesggeAkrliaeggVkvdGevvtrrglkvragdv------------------------