[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for atum0:AAK87761.1


[Show Plain Result]

## Summary of Sequence Search
   1::200
   1::66   2.6e-18 47.0% 0046983 00469831 1/1   rone J-domain                           
   2::68     4e-18 44.8% 0037467 00374671 1/1   rone J-domain                           
   1::72     1e-16 41.7% 0039212 00392121 1/1   rone J-domain                           
   3::60   2.5e-16 44.8% 0048279 00482791 1/1   rone J-domain                           
   1::70   1.1e-15 38.6% 0050633 00506331 1/1   rone J-domain                           
   2::66   2.3e-15 41.5% 0037729 00377291 1/1   rone J-domain                           
   1::70   2.7e-15 38.6% 0045028 00450281 1/1   rone J-domain                           
   1::68   8.5e-15 39.7% 0038551 00385511 1/1   rone J-domain                           
   1::200


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MIDPYVLLGVERDADEAAIKTAYRKVAKAAHPDSGGDGEQFARLQTAYELLKDPVRRRVFDDTGYDPQLA
00469831   1/1  vllllekkdyYeiLgvsrdallsldeikkaYrklalkyHPDkngdeekfkeineAyevLsdpekRa----
00374671   1/1  -lggllsklelldayeiLglsptalldleeikkaYrklalllHPDkggseelfkklneayevLsdeek--
00392121   1/1  lldyyevLgvskdaseeeikkaYrklalkyHPDknpddaeekfkeineAyevLsdpekRalYdqlgeegl
00482791   1/1  --daYkvLgvsplatpeeiKkaYrklalkvHPDKlagpeakeiaeekfkeineAyevLsd----------
00506331   1/1  lllllllllllllklldyYevLgvspdasleeikkaYrklalkyHPDknpgdlseelkelaeekfkline
00377291   1/1  -ldyYelLglspsldadleeikkaYrklalkyHPDknagdseeekelaeekfklineAyevLsdpl----
00450281   1/1  llldyYevLgvspdasleeikkaYrklalkyhPDknpgdeeaeekfklineAyevLsdplkRalYdllll
00385511   1/1  llldyYevLgvspdasleeikkaYrklalkyhPdknpgdgaeekfklineAyevLsdpekRalYdlll--


                         -         -         *         -         -         -         -:140
query           DAKDLKGLLMLETLVNEFILDEREPGSFDPVAAMRRKLTDDILKSRFHILELERHRTRVRKHMDRLGRKP
00469831   1/1  ----------------------------------------------------------------------
00374671   1/1  ----------------------------------------------------------------------
00392121   1/1  sg--------------------------------------------------------------------
00482791   1/1  ----------------------------------------------------------------------
00506331   1/1  ----------------------------------------------------------------------
00377291   1/1  ----------------------------------------------------------------------
00450281   1/1  ----------------------------------------------------------------------
00385511   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           ETDVLSSMLRARSQSIAEAIRNAETQIEAIEQAYTMLEGYSYELETVTLAEPLLKGEAAE----------
00469831   1/1  ----------------------------------------------------------------------
00374671   1/1  ----------------------------------------------------------------------
00392121   1/1  ----------------------------------------------------------------------
00482791   1/1  ----------------------------------------------------------------------
00506331   1/1  ----------------------------------------------------------------------
00377291   1/1  ----------------------------------------------------------------------
00450281   1/1  ----------------------------------------------------------------------
00385511   1/1  ----------------------------------------------------------------------