[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for atum0:AAK87844.1


[Show Plain Result]

## Summary of Sequence Search
   1::378
   4::364  5.1e-95 43.0% 0046669 00466691 1/1   lycosyltransferase/glycogen phosphoryla 
   1::365  2.6e-35 25.4% 0042392 00423921 1/1   lycosyltransferase/glycogen phosphoryla 
   1::363  1.6e-26 23.3% 0047375 00473751 1/1   lycosyltransferase/glycogen phosphoryla 
   1::363  1.1e-22 22.6% 0049238 00492381 1/1   lycosyltransferase/glycogen phosphoryla 
   3::364  2.5e-21 20.9% 0046716 00467161 1/1   lycosyltransferase/glycogen phosphoryla 
  13::363    9e-07 20.2% 0053131 00531311 1/1   lycosyltransferase/glycogen phosphoryla 
   1::142  9.4e-05 23.2% 0043452 00434521 1/1   lycosyltransferase/glycogen phosphoryla 
 151::360  0.00013 18.7% 0044616 00446161 1/1   lycosyltransferase/glycogen phosphoryla 
  12::124  0.00025 21.2% 0051981 00519811 1/1   lycosyltransferase/glycogen phosphoryla 
   1::378


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNKGIVLLAAGGTGGHVFPAEALAHTLKARGYQVHLVTDSRAERYAGKFPADEIHVVPSATIGSKNPISV
00466691   1/1  ---kkillaagGtGGHvfPalalaeellergwevlllgtargleaklvpkagielhlisvgglrgkgllk
00423921   1/1  Mr...vllltggtrGhvqpllalaraLrerGheVrvatppdflelvekaglefvpvggdpaellllpldn
00473751   1/1  M...rilllafgsrGhvnpllalaraLaarGheVtvatp...pafadlveaaglefvplggdplllllll
00492381   1/1  M...rilllavgsrghvlpllalaraLaarGheVtvatppdflelveaaglefvplggdlelllllpllg
00467161   1/1  --mKiliv..tgtrpeiiklaplaralkkrpghevtlivtgqhyglldqfleelgipidpdlplllggls
00531311   1/1  ------------kIllvtpslppvgGvervvlelaralakrghevtvltpgggglle...pgvrvvrlpl
00434521   1/1  MkillvtselpplikvGGlervvlelakaLaarGhevtvvtpgygglladlllllelivlvggrlllvgv
00446161   1/1  ----------------------------------------------------------------------
00519811   1/1  -----------mkiililevapppkvGGaervvlelaraLakrGhevtvitpgyggllpllellvivvvl


                         -         -         *         -         -         -         -:140
query           VRSLWKLWVGLRTARRLVTKLKPVAVVGFGGYPTVPPLLASTGLGVPSIIHEQNAVMGRANKALAARVKA
00466691   1/1  llkallkllkgvlqarkilkklkpdvvlgtgGyvsvPallaArllgiPlviheqnavpGlankllarfad
00423921   1/1  llglvrllaellaelldglvalargwrpdlvvg.gdplalagllaaeklgiPlvrlltgpplppgllnrl
00473751   1/1  vpgllllllllllcellllleallellracwrpDlvv..adplalagllaaealgiPlvllstgpllpts
00492381   1/1  gplalllellrllaalldellellreaalrpDlvvadplal..agllaaealgiPlvllltgpplptsyv
00467161   1/1  ....lalltgrvliglakvlreekpDvvlvhgdtvstlaaalaakklgipvvhveaglrtfdrysgapee
00531311   1/1  lrlp.........lllrllllllrlrrllrrlkpDvvhahsplpgllallaarllgiplvvtlhgllpll
00434521   1/1  lrllldgvkvyrlpapplflrpglpyllpslydyldnalrfalfslaalrrlrrllrrekpDvvhahdwh
00446161   1/1  ----------------------------------------------------------------------
00519811   1/1  lllllglvllllllvllvllllllllllllrplllllldllllllllallllla----------------


                         +         -         -         -         -         *         -:210
query           IAGGFLPPANGQYSEKTVATGNPVRPAVLAASEIPYTPSQTGETFQLVVFGGSQGAQFFSSAVPAAICLM
00466691   1/1  kvavafpdalk.....kvvvvGnPvreeileldalllrlglddglltllvlGGsqGaralnelvpealal
00423921   1/1  larladrvlwdllleelnalrrelglpalplpslllrldlplldafpplllpp...dwppnvvvvGpplr
00473751   1/1  afpppllpdlmsflgrlanrllyllvelllwrllldalnalrre...lglpppsllelllsadlllvnsp
00492381   1/1  phpllpemsflgrllnrllyllvelllwrllldllnrlrrelglpppsllelllspdltlvntspalepp
00467161   1/1  lnrrlidrladlhfapsefarenllk.egipperifvvgnpvidalfklaekalrppllsrselleklgl
00531311   1/1  lpgllsrllrlllrlllrradaviavsealaeellelygvppekivvipngvdldrfrpapdpelraalr
00434521   1/1  sg--------------------------------------------------------------------
00446161   1/1  ----------GvdpervfvvGnpvidalllsreelleklgldlkryvlvtlhrrenlgslenlaealeal
00519811   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           KDEQRKRIVVTQQARPEDKDSVIASYQKLGVKADVSPFFGDMASRIGEADLVISRSGASTVSELSVIGRP
00466691   1/1  lke....glqvvhqtgkgdleevkkayeelgvpnavvlpfiddmaaalaaadlvisRaGaltvaElaalg
00423921   1/1  dvpynlpaeleefl.dagrppVlvtfGSlvaldpnellrallealaklgvrvvlal.......gdsdla.
00473751   1/1  pvldpprplppnvvfvGpllldppaplppeleafLdagrpvvyvsfGSlvlpaellrallealaklgvrv
00492381   1/1  rpdlpnvvvGpllldppyplpaeleeflda..grpvvyvslGSmvvldpeellrailealadlgvrvlls
00467161   1/1  dpdkkvilvtghrrlnedkg...lelllealaellerlpdvrlvivghgntrgrle.likllglpdnvrl
00531311   1/1  erlglpedkpvilfvGrlvprKgldlllealalllkrlpdvrlvivG..dgplreelealaaelgledrv
00434521   1/1  ----------------------------------------------------------------------
00446161   1/1  lellpdllvilpvhpnttvrllllellellpnvllieplgyldflsllkaadlvltdSGgvqe.Eapalg
00519811   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           SILVPYPHALDHDQAANAAALSAAGGASVIKQAELSPQKLSSLLSSALAEPDRLSATAAAAKATGKPHAA
00466691   1/1  lPailvPlpya.ddhQtlNAkalveagaalllleeeltaellaellldl..dpelllemaeaarslalpd
00423921   1/1  lgplpdnvrvvgwv.pldallprvdavvhhGGagttaealaaGvPqvvvPlflasdgDqffnAarvaelG
00473751   1/1  lwklgggdlllgelpdnvlvvdwvPqdallprvdafvhHGGagttaealaaGvPqvvvPlfg....Dqpl
00492381   1/1  lgggdlllge........lpdnvrvvdwv.PqdallprvdavvhHGGagttaealaaGvPqvvvPl....
00467161   1/1  lgplgyldllallaaadlvvtdsG.gvvlEamalGkPvvvlrdtgerpe........lvdagtgilvgt.
00531311   1/1  rflGfvsdlaelyaaadvfvlpSryEgfglvllEAmaaGlPvvatdvgglpevvedgetGllveppg...
00434521   1/1  ----------------------------------------------------------------------
00446161   1/1  vPvlvlrdtterpegveagtvilvgt...........dperileavslllsdpealermaeavnpygdgn
00519811   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           DVLADLVEAIAEGRSVQEFKKKNEGVGA------------------------------------------
00466691   1/1  aaerladlvlelak--------------------------------------------------------
00423921   1/1  aGlvldkseltaesL-------------------------------------------------------
00473751   1/1  naarvarlGaGva---------------------------------------------------------
00492381   1/1  fgDqpfnAarvaa---------------------------------------------------------
00467161   1/1  ..dpeaiaeaierl--------------------------------------------------------
00531311   1/1  .......dpeala---------------------------------------------------------
00434521   1/1  ----------------------------------------------------------------------
00446161   1/1  aseriveill------------------------------------------------------------
00519811   1/1  ----------------------------------------------------------------------