[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for atum0:AAK87903.2


[Show Plain Result]

## Summary of Sequence Search
   1::415
  10::417 4.2e-105 37.3% 0051759 00517591 1/1   airpin glycosidases                     
   8::409  4.5e-65 29.1% 0046841 00468411 1/1   airpin glycosidases                     
  10::355  2.1e-21 27.0% 0049609 00496091 1/1   airpin glycosidases                     
  74::379  2.7e-21 24.0% 0048326 00483261 1/1   airpin glycosidases                     
  15::311  5.6e-09 21.1% 0049995 00499951 1/1   airpin glycosidases                     
   1::415


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPEDDHNSRNWNTLPWHRQWLVKQVEGLFDFFQHRALNPAGGFFDLDAKGAPLQANDPVRGIHASARMVH
00517591   1/1  ---------ltflreelrkwll...etllpfwlgygvdenggfferldddgkp..lphaekrlwlqarql
00468411   1/1  -------msmdllllpsledlleallesllpfwleagfdpenggfgenldddgkvld...apkfpvpqdr
00496091   1/1  ---------IgddvYadalkksllffyaqRsGklpeenragwrgdsalld.......gsdvgvdlsGGwY
00483261   1/1  ----------------------------------------------------------------------
00499951   1/1  --------------dvyllllllalksfyfqrsgvalyaealgksllffeaqrsGklPldqrvnwrills


                         -         -         *         -         -         -         -:140
query           CFSIGHLLGRPGCGDIVDHGMTYLWNNHRDGEHGGYFWQVNDAGPVDATKQGYGHAFVLLAASSAKTVGH
00517591   1/1  wafslayltgdpeylelaehgldfllrhlrdpehggwyfsldadgpldttkylydqafvllAlaeayrtg
00468411   1/1  qvwalavlyrlyertgdpealeladatldalarggrydhlgggfrysvdrdglvpdfekmlydnafllla
00496091   1/1  D.........AGDyvKylvplaytvttLlwayeefpdipesgnglpdlldeakwgldyllkmqds..dgg
00483261   1/1  ---kelldladgyyelladggdegkglfgpypwWttglalgalldlyeltgdpeyldlaekwldfllg..
00499951   1/1  gdsalldlggdgtvdltGGwY..DA.GDhvky..gvpmaysvttLllayevaellglvvldlfkdvllni


                         +         -         -         -         -         *         -:210
query           PLADQMLADITEVLETRFWEEKHGAIAEEFNRDWSPIDNYRGQNSNMHLTEALMAAYEATGDSNYLTKAE
00517591   1/1  dpealelaeelfdfiesrfwdpenGgyregldpdwseledyrnqnanmhlleaalalyeatgdpkylera
00468411   1/1  larayraTgdpkylelaektadwllrrlrdpegGgfydaldads........ansgmhlaeallalyevt
00496091   1/1  lyvqvgdgnldhdcwgrpedmttprdaykrtlsnpgsdvaaetaAalAaasivfkdidpayaaklleaAk
00483261   1/1  pdgdwlvphfe.............ddnaflllallaayeltgdpryldlaeeladyllsrfdte.eGgfy
00499951   1/1  pesgnglpdlldearwgldyLlkmqvddpsdntlygqVgdglsdhnwgrpedmptdrpayridanpgsdv


                         -         -         -         +         -         -         -:280
query           RIADLVIRRRAGELDFRVPEHFDENWTLDKAYRGNEMFRPSGSTPGHWLEWARLILQLWVLGERQHDWMP
00517591   1/1  ekladwvlkrlldpedglllehfdldwsplpdynkddpavlfrgrgynpGhqiewawLllqlarltgdpe
00468411   1/1  gegdpeyldrakkladwllerladelgpedgllyegldedgkpllga......reqrynpghdlewawll
00496091   1/1  elyd..fadknpglysd....digvaggyygs..sgyldellwAaaeLyraTgdssYldyalsladllll
00483261   1/1  swdd.....yddkiiidnngmailalarlyrltgdpkyldlAekaadwilknlldpedgllyhgydfdge
00499951   1/1  aaetAAalAaasrvfkdidpeyaeklleaAeklydfAkknrglyadsisnlggvaggfYgssgyidellw


                         -         *         -         -         -         -         +:350
query           VAAKSLFVQSMALGWDREKGGFFYTLDWNDNPDKRAKLWWPMCEAAGAAHFLNENLPADAFYEDSYRRIW
00517591   1/1  ltadkelleaakrlfdaalengwdpdgtggvfyeldadgspvdddkrwWpqaealkalallyelt.gdek
00468411   1/1  aeaarvtgdp.eyleaAlerladfilkklwdpdtGglyysldrdgkagdpgllddyafWpqaEaiaalla
00496091   1/1  rqagglgglvwefswdnk.................aalallllarltl.....lelyleaaellldsllp
00483261   1/1  vrwqgtld......gyskg.f..Wargqgwllyglaelyeatgdsdplrekyldaakkladallk.fqdp
00499951   1/1  AAaeLyraTgdesYldyaleladnlglrqaa---------------------------------------


                         -         -         -         -         *         -         -:420
query           STIANNFIDHENGGWHEELTEDLVPAHTLFPGKGDIYHALQACLIPLFPAAGSLTTVIKESGGDY-----
00517591   1/1  yldaarklldyifehfiDpenGgWfeyldrdgevlldlkpgktpyhlarallellrllralslanal---
00468411   1/1  lyeatg.dpkyldaaerladyllehfldpedGgwfdtldddgelllrpkegpdgapYHi-----------
00496091   1/1  ngfgl-----------------------------------------------------------------
00483261   1/1  dgGgwyedlddpdlpd.nyketsaaaifa-----------------------------------------
00499951   1/1  ----------------------------------------------------------------------