[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for atum0:AAK87977.1


[Show Plain Result]

## Summary of Sequence Search
   1::155
   9::151  3.1e-22 35.6% 0052099 00520991 1/1   sterase/thiol ester dehydrase-isomerase 
   1::155  3.3e-20 32.1% 0051976 00519761 1/1   sterase/thiol ester dehydrase-isomerase 
   9::157  4.1e-20 30.9% 0042635 00426351 1/1   sterase/thiol ester dehydrase-isomerase 
   4::152  2.2e-19 34.9% 0047414 00474141 1/1   sterase/thiol ester dehydrase-isomerase 
   7::154  2.7e-19 35.0% 0051892 00518921 1/1   sterase/thiol ester dehydrase-isomerase 
   5::155  9.5e-18 32.8% 0048790 00487901 1/1   sterase/thiol ester dehydrase-isomerase 
  17::155  4.2e-14 29.6% 0051502 00515021 1/1   sterase/thiol ester dehydrase-isomerase 
   6::153  1.2e-13 35.5% 0049345 00493451 1/1   sterase/thiol ester dehydrase-isomerase 
   3::155  1.3e-13 30.5% 0044191 00441911 1/1   sterase/thiol ester dehydrase-isomerase 
   9::152  1.3e-12 33.6% 0051977 00519771 1/1   sterase/thiol ester dehydrase-isomerase 
  15::156  9.1e-05 24.8% 0048789 00487891 1/1   sterase/thiol ester dehydrase-isomerase 
   1::155


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRLAELSPIGERVTLDTLHFSAEDIIRFARDFDPQPFHLDAEAARNSVFGGLCASGWHTGAGWMKSFLSH
00520991   1/1  --------lyfellldlealvGevlplldwrtvteedialfaratgdpnpiHldeefakgagfggpiahG
00519761   1/1  mrplglyfedl.evGevlphryprtvtredivlfaratgdtnpihvDeefakghagfggpiahGvltlal
00426351   1/1  --------kllphrfedllvGrvlellsrtvteedivlfalltgdlnpiHldeefakgagfggpiahGll
00474141   1/1  ---fedlevGdrl.sltrtvteedialfaaltgdynpiHldeefakatgfggpiahGmltlallagllga
00518921   1/1  ------vplllvineildllphrypfllvdglyfedlevGevl.sgtrtvteedialfarltgdpnpiHf
00487901   1/1  ----edlrvGdllpdsvlrtvteedivafarltgdynpiHfdpefakaagfpgviahgmltlalllallv
00515021   1/1  ----------------ektvtedeifffghfpgdpvmPgvldleaa............aqtaalllgllg
00493451   1/1  -----dlkvGdrlphllvrtvteedialfarlsgDynpiHldpefAkatgfggpiahGmltlalaagllv
00441911   1/1  --yfeileigdllphrgpfllvdrvlevteedivlfaeltvdpnpphfdghfagdpvfpgvlliEaiaqg
00519771   1/1  --------llltllglyfedlevGqvfdhalgrtvteaeielvsdivlfaaltgdtnplhldeea.....
00487891   1/1  --------------PvtfevtrediilyalavGadtdplyfdyeghpdlvapPtFavvlafgaltpglll


                         -         -         *         -         -         -         -:140
query           WAKEVKRLKLQGLEPPKLGPSPGFRELKWKKPVFAGDDVTYFVTLLDARPLESRPGIWLNITFNEGVNQS
00520991   1/1  vltlalaagllv..........dllpgaglklvlnlgidkvrflrpvfpGdtltaevevldvresksggl
00519761   1/1  lagllgdllp..............glgavlgidevrflrPvfpGDtltaevevlevrekkggpgalvlgi
00426351   1/1  tlalaagllgellggpd........gldklgvlhgedkvrflrPvfpGdtltaeaevvdvrd..krgggg
00474141   1/1  ll..............pglgavlgsdsvrflrPvfpGdtltaevevvsvr.....pgrgivtvevtvtnq
00518921   1/1  dpefakapgfpgviahgmltaalalallve.lpgd...............avlgidkvrflrPvfpGdtl
00487901   1/1  ellp.................vflgid.vrflrpvfpGdtltlev.........skpgrgivtfeveatn
00515021   1/1  ldl.............ggklgallgidevkflkpvlpgdtltlevevlevr.....gglgivkfdgealv
00493451   1/1  .............dllgggaganlgidkvrFlkPVfpgdtlrlevevlg........givtfrvea...n
00441911   1/1  lltlalllglllellg..............glgvllgvdkvrflkpvlpGdtlrlevevlevrr.....g
00519771   1/1  fggrivhGgltfslalglsvl..............alpnavavlgyqslrflaPvfaGDtLtaelevlsl
00487891   1/1  adl..............vlgldlarllhgeqslefhrlPlpagdtltatarvtdvydkgkgalvvtettv


                         +         -         -         -         -         *         -:210
query           GETVLTFQSGVLEFD-------------------------------------------------------
00520991   1/1  lgivtvrveat-----------------------------------------------------------
00519761   1/1  vtvetevtnqdgelV-------------------------------------------------------
00426351   1/1  ivtvevevtnqdgelva-----------------------------------------------------
00474141   1/1  dgelvlegeatv----------------------------------------------------------
00518921   1/1  taevevldk.....--------------------------------------------------------
00487901   1/1  q.gelvle.talvll-------------------------------------------------------
00515021   1/1  d.gelvaegellvlv-------------------------------------------------------
00493451   1/1  qdgevvlegeatv---------------------------------------------------------
00441911   1/1  ..ivtfdveaevd.g-------------------------------------------------------
00519771   1/1  re...rpgtgiv----------------------------------------------------------
00487891   1/1  ...tdaqdgelvatat------------------------------------------------------