[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for atum0:AAK87989.1


[Show Plain Result]

## Summary of Sequence Search
   1::303
   9::303   2e-113 49.3% 0044037 00440371 1/1   porphyrinogen III oxidase               
  13::303 1.1e-108 49.4% 0044813 00448131 1/1   porphyrinogen III oxidase               
   1::303


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MERPILPKGLPEDIEDKKAVAQAWFQHLRDTIVASFETLEDELTGPLSDQEPGRFVQKDWLRDNGEGGGG
00440371   1/1  --------lelldledlrerveellkslqdeivaaleeldg...........gkfledsWereeggGgGi
00448131   1/1  ------------dledlrervealllslqdeivaaleeldgk..........akfkedsWereeg.GgGi


                         -         -         *         -         -         -         -:140
query           KMSMMEGRVFEKVGVHTSTVYGEFSPEFRKQIPGAEEDPRFWASGLSLIAHPVNPNVPAVHMNTRMVVTT
00440371   1/1  srvledGnvfekagvnvSvvlgellpeaalalraegkelelledeklaepeleglkflatGvSlvlHpln
00448131   1/1  srvledGnvfekagvnvsvvlGellpesalalrpeleglkflatGvslvlHplnPlvPtvHlnvrfflae


                         +         -         -         -         -         *         -:210
query           SHWFGGGADLTPVLGRRRTQQDPDTQLFHRAFEITCNRHPIADYPRYKSWCDEYFFLKHRDEPRGTGGIF
00440371   1/1  PlvPtvHlnvrffealekegeepvwWfGGGaDLtPly.....lfeedavhfhktlkdacdkfgkelypkf
00448131   1/1  kegeepvwWfGGGaDLtPly.....lfeedaehfhktlkdacdkfgeelypkfkkwcdeYFflkhrneaR


                         -         -         -         +         -         -         -:280
query           FDWLHPDEEKGGWDANFTFVQDVGRAFNLVYPKIVRANFNQNWTEEDRDEQLIRRGRYVEFNLLYDRGTI
00440371   1/1  kkwcdeYFflkhrneaRGvGGiFfddl....neldleelfafvkdvgdafldaylpiverrknlpyteee
00448131   1/1  GvGGiffddl....neldfeelfafvkdvgdafldaylpiverrlnlpyteeerefqllrrGrYvefnLv


                         -         *         -         -         -         -         +:350
query           FGLKTGGNVESILSSLPPVVRWP-----------------------------------------------
00440371   1/1  refqllrrGrYvefnLvyDrGtl-----------------------------------------------
00448131   1/1  yDrGtlfGlqtggrtesilmslP-----------------------------------------------