[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for atum0:AAK88218.2


[Show Plain Result]

## Summary of Sequence Search
   1::281
  49::277  1.8e-28 29.3% 0047330 00473301 1/1    I-like                                 
  48::280  2.3e-27 27.2% 0049450 00494501 1/1    I-like                                 
  48::276  7.7e-26 26.9% 0052422 00524221 1/1    I-like                                 
  49::275  1.3e-25 25.7% 0052568 00525681 1/1    I-like                                 
  41::275  2.2e-25 24.9% 0050312 00503121 1/1    I-like                                 
  48::275  2.2e-24 26.0% 0052475 00524751 1/1    I-like                                 
  49::276  1.5e-22 26.6% 0047174 00471741 1/1    I-like                                 
  48::275  8.9e-21 24.4% 0051655 00516551 1/1    I-like                                 
  47::276  1.7e-18 24.2% 0035081 00350811 1/1    I-like                                 
  49::278  2.2e-14 26.1% 0048441 00484411 1/1    I-like                                 
  49::278  0.00011 20.7% 0050453 00504531 1/1    I-like                                 
   1::281


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKKNGLLDDEKTALTKNTSLSAFVMQSLRDRRQRQNAAPATKDHSFPVIASYNVHKCVGRDRKFDPDRTS
00473301   1/1  ------------------------------------------------fdlvndlllsllllrlaeptla
00494501   1/1  -----------------------------------------------npgtlrvatwNvnglraadklrw
00524221   1/1  -----------------------------------------------pgtlrvatwNvnglflalaldrr
00525681   1/1  ------------------------------------------------dagtlrvatwNvnglrallwrk
00503121   1/1  ----------------------------------------sssgtl.rvltwNvngl...raalrldrll
00524751   1/1  -----------------------------------------------lriatwNvngl..adwrarldal
00471741   1/1  ------------------------------------------------llrslllllallllssltlrvl
00516551   1/1  -----------------------------------------------splelrvltyNvnglpplfngnd
00350811   1/1  ----------------------------------------------lriatwNvn.....glrarlkrll
00484411   1/1  ------------------------------------------------eakslrvkiltwNvn...glrw
00504531   1/1  ------------------------------------------------ltlrilqwNvnglra.....al


                         -         -         *         -         -         -         -:140
query           RVIQEIGADIIALQEADSRFGERTGLLDLARLERESGLVPVPVQAGVKAHGWHGNVVLFREGAVRDVHTL
00473301   1/1  kdlrlrvaTwNvnglrp.....r.krlldwlaeldsplpDiyvvcLQEvvdlnalnikltdllfpdswle
00494501   1/1  derlallleelldpDivcLQEvk...lrdalldllaallealgydyyfvvsglgrkgygigvailyrkdr
00524221   1/1  arldalldllaellsdpDvvcLQEvedlsdldfllealadllnalagllgykyvfsgslggnggseiglv
00525681   1/1  rlellaellrdeldpDivcLQEvk....lqdaledlleallkalgykyyavvlrlgqkgygegvailyrk
00503121   1/1  elireldpDivcLqEv....klsdelllaallegygyvlvvsgd.....kggggvailsrkplv..vgll
00524751   1/1  ldliaellsdpDivcLQEvklldesfledllealnkllgp.gydyvfvgrkglkgysegvailsrkpile
00471741   1/1  twNvnglrarlkr.r...llellreldpDivcLQEvklq.....dedlleellealgydyvfsgrlgakg
00516551   1/1  drrerlellaellaeldpDvvcLQEvfdlnaadllldnlkkllpyvlavlglansgwdailglyiggflg
00350811   1/1  elleeldpDiicLqEtkltedd...lpaellealgyhvyfsg......qkgysgvailsrlpleevrlgl
00484411   1/1  karlralldllreldpDIvVlclQEvklsaaslflldellklllsllpgydyvlvvsgklggigvailsr
00504531   1/1  dlllqllaelnadilllqE......................pklnpadvilllpgytlyvssrltdgrgg


                         +         -         -         -         -         *         -:210
query           KLPGLEPRGALVVELDLKSGGTLRVIAAHFGLLRHSRAQQAKALVGLLEARNECATILMGDLNEWRLGNG
00473301   1/1  dllealaaalgldygyvlvfsgklggsgvailsrkpivevirsvlvdtvglglggllgnkgalavrlel.
00494501   1/1  velvdsGvailsrypi...levrtgllprvrdalalvirldg.gplvvvnvHlpsggg..laqalallda
00524221   1/1  gdgvailsr.fpivevvrvdlsetgdgdalgnrgalavrlel.ggkpltvvnvHlpsggsgfdgpedlde
00525681   1/1  drvklldsGvailskypilevetg.llddlegrgalaarf.....gplvvvnvHlpsgggderlaqalll
00503121   1/1  lglldsnrgalaarfrlp.grplvvvnvHlpaggse..aqleelldilkslpgdpvillGDfNarpdsld
00524751   1/1  virglllslvptglldldgnrralaarfklpggglkplvvvnvHlpsggseerlaqleelldllkelldg
00471741   1/1  gysGvailsrkpilevlrvv...llgnrgalavrieleggp.lvvvnvHlpaggpgpedleerlaqleel
00516551   1/1  dgGlailsryPivevvqhvfplnggadalanKgalyaridvn.gkpvhvintHlqagysdgakdedlavR
00350811   1/1  llddfdeegraiaaelelp.gtgllvvnvylpaggslvglerldyrlrflelllallaellksgkpvill
00484411   1/1  kpil.evetlefssvgtgldglgnkgalaarlel.ngkrlvvvnvHlpaggsglealesdadrrlrql..
00504531   1/1  vailvrkrlllilrpieldsrdlvavviklsgge.itlisvYlpp.depleefldlldallkklrgkpvi


                         -         -         -         +         -         -         -:280
query           SSLNTFRDAFGTLPPAVPSFPSNLPVLALDRIIANREGLIEQVEAHDSALARIASDHLPLKAAIRTDLLP
00473301   1/1  ggtplvvvntHlpaggsggdeRlaqllllldllrflleelladgdpvilaGDfNaridlpdsdvyrl---
00494501   1/1  lrellkkllapgdpvlslillGDfNaapdsldlrlllelglvdafrllhpgtytwws...glrlDyilvs
00524221   1/1  RlaqlealldllkelrlapgdpvillGDfNaapdsldyklllsllkksglldafregligflptyk----
00525681   1/1  ldllkellkklspgdpvillGDfNaapdsl..qlllelglvdafrllhpgaytwwsglrlDyilv-----
00503121   1/1  lklltllpeereafrelledlglvdtyrelipdgrryTwwsyrgpargrlDyilvspglldrvvs-----
00524751   1/1  dpvillGDfNarp.........nsdqlrllleerglldlllelgltdaptykypgptgylDyilv-----
00471741   1/1  lellkelasgdpvillGDfNarpdsidvynlkslrgnagflleerdalrelldelglvdafrelhp----
00516551   1/1  laqleellefiksltipkgdpvivaGDfNvrpgsde.....yklllellsdafvegeggfgptyd-----
00350811   1/1  GDfNiapddldlknlksnlknklllglvgftplerelldglldlglvdafrllhptygglyTwwdy----
00484411   1/1  .lllasgdpvilcGDfNfrlslpgsdvyrlltnglldlllefdqlrelldgllflglvdaprtfppty--
00504531   1/1  laGDfNahhtlwgsfrvnergelllelidtlgllllneggtpTfwslrrrgnrgsriDltlvspalad--


                         -         *         -         -         -         -         +:350
query           A---------------------------------------------------------------------
00473301   1/1  ----------------------------------------------------------------------
00494501   1/1  ----------------------------------------------------------------------
00524221   1/1  ----------------------------------------------------------------------
00525681   1/1  ----------------------------------------------------------------------
00503121   1/1  ----------------------------------------------------------------------
00524751   1/1  ----------------------------------------------------------------------
00471741   1/1  ----------------------------------------------------------------------
00516551   1/1  ----------------------------------------------------------------------
00350811   1/1  ----------------------------------------------------------------------
00484411   1/1  ----------------------------------------------------------------------
00504531   1/1  ----------------------------------------------------------------------