[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for atum0:AAK88284.1


[Show Plain Result]

## Summary of Sequence Search
   1::427
  30::334    5e-42 30.8% 0046579 00465791 1/1   AD(P)-binding domain                    
  30::401  4.5e-40 32.6% 0048771 00487711 1/1   AD(P)-binding domain                    
  30::393  6.4e-36 31.6% 0046057 00460571 1/1   otide-binding domain                    
   1::388  1.6e-34 31.0% 0046446 00464461 1/1   AD(P)-binding domain                    
  10::327  3.6e-32 33.2% 0052911 00529111 1/1   AD(P)-binding domain                    
  13::390  1.4e-31 29.4% 0046270 00462701 1/1   AD(P)-binding domain                    
   1::390  1.5e-31 28.9% 0049150 00491501 1/1   AD(P)-binding domain                    
  27::406  2.2e-31 28.8% 0047022 00470221 1/1   AD(P)-binding domain                    
   1::390  3.1e-31 27.4% 0037441 00374411 1/1   AD(P)-binding domain                    
   1::241  1.6e-30 35.2% 0049222 00492221 1/1   AD(P)-binding domain                    
  13::390  6.2e-30 27.8% 0049003 00490031 1/1   AD(P)-binding domain                    
   9::413  4.8e-29 27.8% 0039664 00396641 1/1   AD(P)-binding domain                    
  30::242  7.4e-29 35.5% 0048356 00483561 1/1   AD(P)-binding domain                    
  30::399  1.7e-28 30.4% 0035989 00359891 1/1   AD(P)-binding domain                    
  27::389  6.5e-28 31.7% 0052032 00520321 1/1   AD(P)-binding domain                    
  30::241  5.7e-27 36.3% 0045795 00457951 1/1   otide-binding domain                    
  31::352  7.2e-27 27.6% 0052313 00523131 1/1   AD(P)-binding domain                    
  29::390  1.9e-26 27.6% 0052926 00529261 1/1   AD(P)-binding domain                    
  30::242  1.9e-26 24.9% 0048494 00484941 1/1   AD(P)-binding domain                    
  31::387  1.9e-26 27.3% 0045881 00458811 1/1   AD(P)-binding domain                    
  30::394  1.4e-25 30.4% 0052600 00526001 1/1   AD(P)-binding domain                    
  22::389  1.6e-25 28.5% 0036092 00360921 1/1   AD(P)-binding domain                    
  31::392    4e-24 28.1% 0043577 00435771 1/1   AD(P)-binding domain                    
  27::399  2.2e-22 26.9% 0041341 00413411 1/1   AD(P)-binding domain                    
  27::394  1.1e-21 28.2% 0046514 00465141 1/1   AD(P)-binding domain                    
  31::395  2.2e-21 30.3% 0040035 00400351 1/1   AD(P)-binding domain                    
  31::394  2.2e-21 31.5% 0045518 00455181 1/1   AD(P)-binding domain                    
  27::240  3.1e-21 28.9% 0047682 00476821 1/1   AD(P)-binding domain                    
  30::408  1.6e-20 26.2% 0040049 00400491 1/1   AD(P)-binding domain                    
  30::393  1.6e-20 28.0% 0045870 00458701 1/1   AD(P)-binding domain                    
  27::237  2.6e-20 28.8% 0050363 00503631 1/1   AD(P)-binding domain                    
  30::395  3.4e-20 28.0% 0046834 00468341 1/1   AD(P)-binding domain                    
  29::392  4.5e-20 27.9% 0040602 00406021 1/1   AD(P)-binding domain                    
  31::394  1.6e-19 28.6% 0038074 00380741 1/1   AD(P)-binding domain                    
  27::242  1.8e-19 26.8% 0047029 00470291 1/1   AD(P)-binding domain                    
  26::241  2.3e-19 27.2% 0046128 00461281 1/1   AD(P)-binding domain                    
  31::240  4.7e-19 27.3% 0042446 00424461 1/1   AD(P)-binding domain                    
   1::244  3.9e-18 32.3% 0036459 00364591 1/1   otide-binding domain                    
  30::242  4.1e-18 31.3% 0047564 00475641 1/1   AD(P)-binding domain                    
  31::386  5.2e-18 25.9% 0047712 00477121 1/1   AD(P)-binding domain                    
  29::251  9.6e-18 32.4% 0048607 00486071 1/1   AD(P)-binding domain                    
  27::387  1.7e-17 29.6% 0036300 00363001 1/1   AD(P)-binding domain                    
  29::394  2.2e-17 33.1% 0037643 00376431 1/1   AD(P)-binding domain                    
   1::244  2.7e-17 31.7% 0048807 00488071 1/1   otide-binding domain                    
  31::392    5e-17 28.7% 0040688 00406881 1/1   AD(P)-binding domain                    
  16::237  9.7e-17 29.2% 0047270 00472701 1/1   AD(P)-binding domain                    
  31::401  1.2e-16 28.6% 0049990 00499901 1/1   otide-binding domain                    
  27::237  6.2e-16 28.4% 0053321 00533211 1/1   AD(P)-binding domain                    
  31::242  1.3e-15 35.6% 0052963 00529631 1/1   AD(P)-binding domain                    
  30::236  2.4e-15 31.9% 0036889 00368891 1/1   AD(P)-binding domain                    
  27::257  2.6e-15 28.7% 0040660 00406601 1/1   AD(P)-binding domain                    
  31::393  2.9e-15 26.3% 0046760 00467601 1/1   AD(P)-binding domain                    
  30::247  3.9e-15 30.1% 0047133 00471331 1/1   AD(P)-binding domain                    
  30::242  1.3e-14 26.7% 0044413 00444131 1/1   AD(P)-binding domain                    
  20::237  1.4e-14 34.6% 0047068 00470681 1/1   AD(P)-binding domain                    
  29::237  6.4e-14 34.4% 0048365 00483651 1/1   AD(P)-binding domain                    
  30::246    9e-14 22.4% 0046274 00462741 1/1   AD(P)-binding domain                    
  30::242  9.9e-14 27.9% 0048583 00485831 1/1   AD(P)-binding domain                    
  26::240  1.3e-13 37.6% 0047141 00471411 1/1   otide-binding domain                    
  31::392  3.3e-13 27.4% 0048199 00481991 1/1   AD(P)-binding domain                    
  25::391  7.9e-13 26.0% 0050148 00501481 1/1   AD(P)-binding domain                    
  30::238  9.1e-13 33.3% 0048045 00480451 1/1   AD(P)-binding domain                    
  17::238  1.4e-12 29.2% 0048866 00488661 1/1   AD(P)-binding domain                    
  18::237  3.1e-12 34.3% 0050961 00509611 1/1   AD(P)-binding domain                    
  30::238  4.5e-12 32.3% 0053322 00533221 1/1   AD(P)-binding domain                    
  30::238  4.9e-12 32.3% 0048009 00480091 1/1   AD(P)-binding domain                    
  31::392  5.8e-12 27.0% 0046416 00464161 1/1   AD(P)-binding domain                    
  25::391  1.1e-11 23.9% 0044098 00440981 1/1   AD(P)-binding domain                    
  30::236  1.2e-11 30.8% 0047565 00475651 1/1   AD(P)-binding domain                    
  30::237  2.3e-11 28.3% 0036654 00366541 1/1   AD(P)-binding domain                    
  17::237  3.7e-11 31.0% 0044705 00447051 1/1   AD(P)-binding domain                    
  19::237    4e-11 35.7% 0047271 00472711 1/1   AD(P)-binding domain                    
  30::237  4.8e-11 34.3% 0046750 00467501 1/1   AD(P)-binding domain                    
  29::237  7.4e-11 35.0% 0050927 00509271 1/1   AD(P)-binding domain                    
  31::237  1.2e-10 26.9% 0046156 00461561 1/1   otide-binding domain                    
  22::238  4.3e-10 31.3% 0049679 00496791 1/1   AD(P)-binding domain                    
  30::238  6.4e-10 31.5% 0038449 00384491 1/1   AD(P)-binding domain                    
  30::237  6.5e-10 33.7% 0050960 00509601 1/1   AD(P)-binding domain                    
  31::240  9.8e-10 28.0% 0047327 00473271 1/1   otide-binding domain                    
  31::245    2e-09 29.0% 0047909 00479091 1/1   )-binding Rossmann-fold domains         
  27::111  6.1e-09 33.3% 0045797 00457971 1/2   AD(P)-binding domain                    
  14::237  1.3e-08 32.1% 0038285 00382851 1/1   AD(P)-binding domain                    
  17::239  1.7e-08 31.8% 0048584 00485841 1/1   AD(P)-binding domain                    
  18::237  1.7e-08 29.1% 0050364 00503641 1/1   AD(P)-binding domain                    
  27::237    2e-08 31.1% 0048865 00488651 1/1   AD(P)-binding domain                    
  31::238    2e-08 32.2% 0036301 00363011 1/1   AD(P)-binding domain                    
  31::238  3.5e-08 32.6% 0048200 00482001 1/1   AD(P)-binding domain                    
  17::237  4.6e-07 26.7% 0038468 00384681 1/1   AD(P)-binding domain                    
  30::238  6.3e-07 32.3% 0046972 00469721 1/1   AD(P)-binding domain                    
  30::237  1.2e-06 32.5% 0045519 00455191 1/1   AD(P)-binding domain                    
  30::237  1.5e-06 28.6% 0048364 00483641 1/1   AD(P)-binding domain                    
  30::239  4.6e-06 28.7% 0046761 00467611 1/1   AD(P)-binding domain                    
  18::236  2.1e-05 31.8% 0052964 00529641 1/1   AD(P)-binding domain                    
  29::62   2.7e-05 41.2% 0044559 00445591 1/1   )-binding Rossmann-fold domains         
  25::62   4.2e-05 31.6% 0045481 00454811 1/1    N-terminal domain                      
  31::236  9.9e-05 24.4% 0041940 00419401 1/1   AD(P)-binding domain                    
  28::110  0.00012 40.3% 0048108 00481081 1/1   AD(P)-binding domain                    
  31::239  0.00013 30.7% 0040619 00406191 1/1   AD(P)-binding domain                    
  28::66   0.00018 41.7% 0048016 00480161 1/1   otide-binding domain                    
  31::59   0.00021 48.3% 0042342 00423421 1/1   )-binding Rossmann-fold domains         
  31::238  0.00026 29.3% 0046973 00469731 1/1   AD(P)-binding domain                    
  29::62    0.0003 38.2% 0047992 00479921 1/1   )-binding Rossmann-fold domains         
  30::62   0.00031 39.4% 0047276 00472761 1/1   )-binding Rossmann-fold domains         
  20::241  0.00034 32.0% 0046344 00463441 1/1   AD(P)-binding domain                    
  31::65   0.00071 48.6% 0036016 00360161 1/1   AD(P)-binding domain                    
 150::237  0.00072 23.9% 0045797 00457972 2/2   AD(P)-binding domain                    
  29::62   0.00077 35.3% 0050443 00504431 1/1   )-binding Rossmann-fold domains         
   1::427


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MYNDPRSHGLWEKTAPQPPVTPALQGDAVADVVVVGGGFTGQSAALHLAEGGLDVILLEAKEIGFGGAGR
00465791   1/1  -----------------------------mkeyDvvIiGaGiaGlsaAlrLakaGlkVlvlEkgdrpGgr
00487711   1/1  -----------------------------kydvviiGaGiaGlsaAleLarrGlkdVtvlErgplpgggg
00460571   1/1  -----------------------------pmmskkkdvvViGaGiaGlsaAlaLaraGysVtvlErgdrp
00464461   1/1  Mm..p..lslllatalelplp.alaldkkyDvvViGaGpaGlaaAlalaraGlkVlllEkgdrlG.Gtsl
00529111   1/1  ---------llsnlplgrllpfllptslwldtlplpllellisraileralpdldmdkeyDVvIvGAGpa
00462701   1/1  ------------MMsplllalllllpllllaldeeydvvviGaGpaGlaaAlalaraGlkVlllEkgdrl
00491501   1/1  MirvcpalceslvvlaaglepplpplsaskkkdvvviGaGpaGlaaAyrLaraGlkVtvlEardrlG.Gr
00470221   1/1  --------------------------m..yDVvviGgGiaGlaaAlrLaraGlkVlvlEagdrlGGrlrt
00374411   1/1  MpvligllesliidtalllgllpplsaskkydvvviGaGpaGlaaAleLaraGlkVtvlEardrlGGrlr
00492221   1/1  MmktpvliklleslladtalrlpplpplsldeeyDVvvvGAGpaGlaaAyeLarapGlkVlvlEkgdrlG
00490031   1/1  ------------lMlpeslleplpalsaseeydVvViGaGpaGlaaAlalaraGlkVlllEkgprlggts
00396641   1/1  --------MsylasaallaalpslletieyDVlviGgGpaGlsaAlelarlapdaGlkValvEkgdlggg
00483561   1/1  -----------------------------ydvviiGaGiaGlsaAlrLaraGlkVlllEkgdrlGGtsgr
00359891   1/1  -----------------------------yDvviiGaGpaGlsaAlrLaraG.kVlvlEkgpvlggtsgl
00520321   1/1  --------------------------MmdeeyDvviiGaGpaGlsaAlrLaraGlkVlvlEkgpllggts
00457951   1/1  -----------------------------yDVvIiGaGpaGlsaAlrLaraGldlgselkVtvlEkgdrl
00523131   1/1  ------------------------------msydVvvvGAGiaGlsaAlaLarrGlrvlllergdvlgga
00529261   1/1  ----------------------------lniksielflsiieraldeglvppsmemmmekydvvIiGaGp
00484941   1/1  -----------------------------aakkydvvIiGaGpaGlaaAlrLaraGlkVtvlEkgdrlG.
00458811   1/1  ------------------------------llydvvIiGaGpaGlsaAlrLaraGlkVlvlEkGplvnrd
00526001   1/1  -----------------------------MseeyDvvvvGaGpaGltaAleLaraGlkVlllEagdrvgG
00360921   1/1  ---------------------pplmmdeeydvvViGaGpaGlaaAlrLaraGlkVlvlEr..gGrlasgr
00435771   1/1  ------------------------------dVaviGAGiaGlaaAyeLaraGlkVtvlEardrlGGrsrt
00413411   1/1  --------------------------MpmsseeyDvvViGaGpaGlaaAlrlaraGlkVlllEkgpvlgG
00465141   1/1  --------------------------eieydvvViGaGpaGlaaAlrlaraGlkVtviEkgprlggcl..
00400351   1/1  ------------------------------DvvvvGaGpaGlaaAlrLaraGlkVlvlErgdrpG.Gtsl
00455181   1/1  ------------------------------dvvviGgGpaGlaaAlrlaeaGlkvlvlEkgdrlgglsnr
00476821   1/1  --------------------------lallslllllllglllalpdlamdkeyDvvvvGaGpaGltaAlr
00400491   1/1  -----------------------------yDvvvvGaGpaGlaaAlalaragpdlkvaliekgplgggas
00458701   1/1  -----------------------------ydVvvvGAGiaGlaaAlrLaeaGltdvlvlEagdrvG....
00503631   1/1  --------------------------masmsmkydvvIiGaGpaGlaaAlrLaraGlkvtvlEkgprlGg
00468341   1/1  -----------------------------smasesdydvvIiGaGpaGlsaAlrLaralgklpGlkVtvl
00406021   1/1  ----------------------------MseyDvvvvGaGpaGlaaAlrlaraGlkvlllEkgdrlggts
00380741   1/1  ------------------------------keydvvviGgGpaGlaaAlrlaraGlkvlllekgdlgggc
00470291   1/1  --------------------------lllllslsllllllsslllmmskeyDvviiGaGpaGlvaAlrLa
00461281   1/1  -------------------------glellllslltemmskeyDvvvvGaGpaGlvaAlrLaedaGlkVl
00424461   1/1  ------------------------------vPrvlpipgidlggvlhaldfldpkalkgkkVaviGaGpa
00364591   1/1  mgrvcppcegaclllllagpvailllepaladelllgllplllpamskkkdvvvvGaGpaGlaaAlalar
00475641   1/1  -----------------------------lldkeyDVvviGgGpaGlaaAlrlaraGlkvlllEkgd.rl
00477121   1/1  ------------------------------ektdVaIvGAGpaGlaaAlaLaraGldvtvlErrdrpggt
00486071   1/1  ----------------------------myDvviiGaGpaGlaaAlrLaraGlkVlvlEkdrl..GGtcl
00363001   1/1  --------------------------mekydvvviGaGlaGlsaAlelaragldvtvlergprlggclll
00376431   1/1  ----------------------------eydvvvvGaGpaGlaaAlalaraglkvlllekgprlg...gl
00488071   1/1  irvcilcelacllllllgpvlilllelaaalllpllllpatkkkdvaviGaGpaGlaaAlalaraGlkVt
00406881   1/1  ------------------------------dvvviGgGpaGlaaAlrlaraGlkvlllekgdrlggllla
00472701   1/1  ---------------ledllldllsmstkkdvvviGaGpaGleaAlalarlglkvtlierg...lGgtll
00499901   1/1  ------------------------------kkdvvviGAGiaGlaaAlrLaeaGhkVtvlEardriG.Gr
00533211   1/1  --------------------------mekydvviiGaGpaGlaaAlrlaraGlkvlvlEkgprpgglsrl
00529631   1/1  ------------------------------mptkkdVaiIGAGpaGLaaAllLaraGhdldVtvfErrdr
00368891   1/1  -----------------------------ppipglellltsddalellelpkdvvviGgGpaGleaAlal
00406601   1/1  --------------------------MddlpeeyDVvViGaGlaGlaaAaaLaraGlrVlvlEkrdr.lG
00467601   1/1  ------------------------------MkeyDvvviGaGpaGlaaAlrlarlgldkvlviekgpllg
00471331   1/1  -----------------------------tmkydvviiGaGpaGlaaAlrlaraGlkvlllEkgprlgyk
00444131   1/1  -----------------------------MsdedyDviviGaGiaGlvaAarLakaGlkVlvlEkgdr.l
00470681   1/1  -------------------lllllmmmlhydvvviGgGpAGlaaAlrlarldpgarvllieke....pgl
00483651   1/1  ----------------------------ipgldlpgvlllltsddalallellllakpkdvvviGgGpaG
00462741   1/1  -----------------------------mlMkkkyDviiiGaGpaGlaaAleLaraGlkVlvlEkgdrl
00485831   1/1  -----------------------------lsedkeyDVvviGgGpaGlaaAlalaraGlkVlllEkgpel
00471411   1/1  -------------------------mstkkdvaiiGaGpaGlsaAiyLaraGlddvtvlEknd.rlgGrl
00481991   1/1  ------------------------------klllatgslplipplegllldgvlllrtlldalallemlk
00501481   1/1  ------------------------lmeleydvvviGgGpaGlaaAlylaraglkvtliekgplllyalgg
00480451   1/1  -----------------------------pgldlelvltsddlldleelpkdvvviGgGpaGleaAlala
00488661   1/1  ----------------srprvlpipgldlegvlllrtlldsdallellalpkdvvviGgGpaGleaAaal
00509611   1/1  -----------------lPrllpipglegvlllrtlldsdlllellelpkdvvviGgGpaGleaAlalar
00533221   1/1  -----------------------------ipgldlegvltsrdlldllelpkdvvviGgGpaGleaAlal
00480091   1/1  -----------------------------ppipglegvltsrdlldllelpkdvvviGgGpaGleaAlal
00464161   1/1  ------------------------------MleydvvviGgGpaGlaaAlrlaraGlkvlliekgdr.lG
00440981   1/1  ------------------------MeskkydvvviGaGpaGlaaAlylaraglkvtllekgprlggllnt
00475651   1/1  -----------------------------pipgldlegvltsrdlldllelpkdvvviGgGpaGleaAla
00366541   1/1  -----------------------------vlpipgldgegvltsrdlldllelpkdvvviGgGpaGleaA
00447051   1/1  ----------------arprllpipgedlflgkgvltsatilgalllfkgkdvvviGgGpaGleaAlyla
00472711   1/1  ------------------PrlpdipglelflgkgvhtsatldgllfkgkdvvviGgGpaGleaAlalarl
00467501   1/1  -----------------------------kkkdvvvvGgGpaGltaAlrlarlgpdlevtliekgdrlgg
00509271   1/1  ----------------------------vydvviiGaGpaGlaaAlrlaraglklsevlllekdrlggti
00461561   1/1  ------------------------------gkkvaviGaGpaGlaaAllLakalpghdvtvfEkgpvpgg
00496791   1/1  ---------------------PgipgleeflgkgvhtsatldglefrgkdvvviGgGpaGleaAlylarl
00384491   1/1  -----------------------------lpgvellltsddalaleelpkdvvviGgGpaGleaAlalar
00509601   1/1  -----------------------------kdvvviGgGpaGleaAlalar.glkvtliergdrlggtrpl
00473271   1/1  ------------------------------MyDviviGaGiaGlaaAyrLakaGlkVlvlEkgdr.lGGr
00479091   1/1  ------------------------------mmsylplfldlkgkrVliiGgGpaGltaAlelakaGakvt
00457971   1/2  --------------------------sekydvviiGaGpaGlaaAlrlarlaglkvlliekg..rlggll
00382851   1/1  -------------srPrvlpipgldlegvlllrtledalellellelpkrvvviGgGliGlelAaalrel
00485841   1/1  ----------------rPrvppipgldlvltsddlldleelpkdvvviGgGviGleaAlalarlgakvtv
00503641   1/1  -----------------epklPdipGledFkgelfhsarwphdlvdltgkrVaviGaGpaGlaaaaelak
00488651   1/1  --------------------------mlpkdvviiGgGpaGleaalalarlglklevtliergdr.lggt
00363011   1/1  ------------------------------ppipgldlegvftlrtlddalalreallagkrvvvvGgGl
00482001   1/1  ------------------------------llpipglevltsdgaldllelpkdvvviGgGpaGleaAla
00384681   1/1  ----------------ftprvlpipgeeacglltadepvailflerlihsyavkdgppftgkdVaViGaG
00469721   1/1  -----------------------------dlpgvellltsddalalkelpkdvvviGgGpaGleaAlala
00455191   1/1  -----------------------------ppipgvellltsddalalkelpkdvvviGgGpaGleaAlal
00483641   1/1  -----------------------------ydvviiGgGpaGltaaiylarlgpdlkvtliek.....ggt
00467611   1/1  -----------------------------gvlllltsddalalkelpkdvvviGgGyiGleaAlalarll
00529641   1/1  -----------------ePripdipglleefkgkvlhsaayrdpedfkgkrVvViGaGaSgldialelak
00445591   1/1  ----------------------------pkkvaviGaGgvGlalAlllaaagggdVtlvDid--------
00454811   1/1  ------------------------tdlkgkrVvViGaGlsGlaaarlllrlGaevtvldrrd--------
00419401   1/1  ------------------------------lPdipglelvltsddalelkepkkvvviGgGyiGleaAsa
00481081   1/1  ---------------------------aalliliaslglellpadylvlaigssdgaldlpklpkrvvvv
00406191   1/1  ------------------------------prvlpipGedlcgvlslrdfvgdynlhpaawllppdltgk
00480161   1/1  ---------------------------tgkkVavvGaGpAGlaaAaqLaraldlseelghdvtvfe----
00423421   1/1  ------------------------------ldllplfldlrgkdvlviGgGdvGlaaar-----------
00469731   1/1  ------------------------------dipglellltsddalalkelpkdvvviGgGyiGleaAaal
00479921   1/1  ----------------------------pkkvaviGaGavGlalAlalaraGaageVvlvdr--------
00472761   1/1  -----------------------------ysrplllgligllgakvlpgkkvaviGaGgvGl--------
00463441   1/1  -------------------vviatgsapvvitqlpipgadlarvltleevllgkaktgkrVlVvdgGgGp
00360161   1/1  ------------------------------prklgiPGedlpgvfsardfvawynglpdaallep-----
00457972   2/2  ----------------------------------------------------------------------
00504431   1/1  ----------------------------lmeikkvaviGaGlmGlgiAavlaraGleVvlvd--------


                         -         -         *         -         -         -         -:140
query           NVGLINGGMWVMPKELPDVLGETYGERLLDLLGDAPVLVRELVEKHGIPCEIEKNGTLHCAVGEKGLAEI
00465791   1/1  gasgrnaggia.............pglgyddrllalakeslellkelgaelgidl.frppgklvvaggg.
00487711   1/1  asgrnagllhaglayle..............larlaresldllrelveelgid..frrygklvlatgeae
00460571   1/1  ggtsgtnggllaaglvap......llllpggipllalalealdllrelglelgidf...rvgalvlatgl
00464461   1/1  taggilldlgarllegl.................glldlleelleelgielrllrdgklvvaltgeg...
00529111   1/1  GLsaAyyLakarPglkVlvlEkgdrpGGasgrnggilpsglltde.........................
00462701   1/1  G.Gtslrsggilldgglrllegl.................glldrleelleelgieldllvdgrlvvala
00491501   1/1  s.rtaglippgflldlgahvfpglaplllellee.lgle.lelltlagaavlalldgklidlpadvarll
00470221   1/1  vrlgggtsldlggivfpglypallelleelglelallaldg..ellayldglvlelgidlntl.....vv
00374411   1/1  taripglgasldlggilfpglsprllellaelgle.aelarllglrvlilldgtvvsldgdld.......
00492221   1/1  .Gts.rnggvipdgglld........................pelldlleelGlpfdl............
00490031   1/1  clnggglppggl................rylag.lglldlleelaeelgidldflrdgllvlaldgegl.
00396641   1/1  asgrsgggiaaglrllienylgldlaellvedlvkggaglvdedlve.......................
00483561   1/1  naglipgglrldaall...........lvrlalesldalreliatgarplglpipgrdlgglllardald
00359891   1/1  ngggipggllld........................dllerlgedlliglallvdgdlvvvltgeg....
00520321   1/1  glngggihaglskllldlrdlleelgvelllggaglvdprgvellgelg.....leadalllatG.rpfd
00457951   1/1  GGtsglnaglipp...........glggplddrglalaeetlellrelgaelglldglvrpngalvlaig
00523131   1/1  scrnsggg.lakgllleelpal................................................
00529261   1/1  aGlaaAlrLlqlAaraGpdlkVtvlEkgdrlGGtsrtnggliprgl................eelldelg
00484941   1/1  Grs.rtggypgfpiidsgallf....................pellpyllellkelglelrlpdlggrvv
00458811   1/1  rlGGts..nggdgrldlgahvfflllppgllellaelglplglelldlleelleelgidfllgkgvg...
00526001   1/1  tslrngglphkglreladrlielleelgvelllntvvgalltlaellaeydavvlalg.lglatglagrg
00360921   1/1  ipgklldggahllpglleellaglg..dlaellalkpelvalledgaaill.lprgvrllaglglggssa
00435771   1/1  vgypgfrldlgaglipgs.ypyllelleelglelairlntevggavllpdg..glltvprdladllaell
00413411   1/1  tssrn....qggirldlgaipl......................dlleelgldlvkggdgltleagalvl
00465141   1/1  nvgcipgkaldaaall....................lrllelleelgvelr...................
00400351   1/1  tnggpgfkldlgaalllg............pelleelgteaael...laergvrvlrgkglgggstinad
00455181   1/1  ng..ipglrlllgalll....................rllelleelgipfd...................
00476821   1/1  Lae.GlkVlvlEa.....ggrlggrgatpsgggflvdtgadwlfgtepelglegrgillprgkvlGGssl
00400491   1/1  clngggipakllle.............dllerlvvdllkggailvdedlvelldge..............
00458701   1/1  .........Gra.rtvrypgfrfdlgahvflgpggelleylldlleelgleddlrlntevggarlllpdg
00503631   1/1  twrt..grypglllllpallyllldlpllf........................................
00468341   1/1  Ekg.prpggrsrggglypgglellrelgledeleelgvdflkalvvlldldlv.................
00406021   1/1  llgggllnagdildklgllaallvrladalvlatgarprrlgipglelp.....................
00380741   1/1  lnvg.....................cipgkrllaaaelydelrelleelgipfd................
00470291   1/1  elaGlkVlvlEa.....GGtarnggyigskpdlgaalfgelldelyelgle...............ldgr
00461281   1/1  vlEagdrlgGa.....scipsgaglgadlgltllpglfdtll..............agldgrdllarrgk
00424461   1/1  GlaaAlyLarlGaevtvierrprlggtllalgripakllglealllrllllllglglll...........
00364591   1/1  aGlkvtllekgdr.lggrlllvg...............................................
00475641   1/1  gGtclnsgcipskalllaalglllllgaalfglllllllllldlvllgaakralgae.............
00477121   1/1  algrggalsprgl.................elleelgll...............................
00486071   1/1  nvgcipskallyagllpdelelleelglpl...lpgldipvlpgrkgg......................
00363001   1/1  lsvp..................................................................
00376431   1/1  lvglipsklll...........................................................
00488071   1/1  llEardr.lggrlllsggipgk................................................
00406881   1/1  g..cipgkallaaalllrllellaelgiellllpypgvdlslv...........................
00472701   1/1  nggpglskpll...........................................................
00499901   1/1  srtnggllipglrl..dlgahlfpgsy.ellldlleelgvelrlntrvv.vdr...dgklvtvpldldgl
00533211   1/1  nggggaaldlpsklllrlldll................................................
00529631   1/1  pG..Glwrttgrigsgldlgpsll..........rlleelgl............................
00368891   1/1  arlglkvtliergdrlgglld.................................................
00406601   1/1  GtsatsrypGfrfdvggsllpgtipgllrllrelgledlell.......plglagvirgggsvvnalpde
00467601   1/1  gqtllllggtclnvgcipskllllaallpellelleglgvefdleekgvdldglrlaydklv........
00471331   1/1  tllalGgllltvglipgkallgaall............................................
00444131   1/1  GGtaatlgldglkfdlggsvihgllypallrllrklgldlgpkilhalgelvdlllrtdvsdylefrlld
00470681   1/1  gynrgclpkklllaaaelldlllelaglgll.......................................
00483651   1/1  leaAlalarlGakVtviergdrlggrll..........................................
00462741   1/1  GGtwasngipgipsdggaavilgpellellrelgi.elgpkvpeildyllklldkf..dllklleflskv
00485831   1/1  ggtclaaggipskallllalgllllelaallgillllllld.............................
00471411   1/1  l..ggipg..............................................................
00481991   1/1  keydvvviGgGpaGlaaAaylarlGlkvlliekgprl.ggtclnvgcipskallkaaelaeliellpglg
00501481   1/1  lllyvgcilskall........................................................
00480451   1/1  rlgakvtlverrdrlgglld..................................................
00488661   1/1  arlgakvtlvergdrlggtlld................................................
00509611   1/1  lglkVtliergdrlgg.ld...................................................
00533221   1/1  arlgaevtvvergdrlgglld.................................................
00480091   1/1  arlgaevtvvergdrlgglld.................................................
00464161   1/1  Gtllntgcipgkalllgalll.............................ellrellelgglflllpdld
00440981   1/1  gcgpsklllpgall........................................................
00475651   1/1  larlgakvtvvereprlggtld................................................
00366541   1/1  aalarlgakvtvvergdrlggtld..............................................
00447051   1/1  rlgakvtlierrdrlggtl...................................................
00472711   1/1  glkvtllerrprlggtl.....................................................
00467501   1/1  .tpllpgvlggk..........................................................
00509271   1/1  l.....................................................................
00461561   1/1  ll..rygiapd...........................................................
00496791   1/1  glkvtlierrdrlggd......................................................
00384491   1/1  lglkvtvver.drlggtl....................................................
00509601   1/1  lsgvipgkll............................................................
00473271   1/1  aatfrldgfrvdnvgahpfkgl..npelldllkelgledkldl....rrlvllrgkvlggpsdlngllav
00479091   1/1  lverdpr...............................................................
00457971   1/2  ll..layggillrvgfiplkrlaelleallelaeklgveil-----------------------------
00382851   1/1  lpklglevtlveagdrl.....................lpryldpelsklll..................
00485841   1/1  vergdrllgtld..........................................................
00503641   1/1  aglevtvfertprigglwr...................................................
00488651   1/1  llplgpgpll............................................................
00363011   1/1  aGleaAaalrrlglevtlvergdrlllpyl........................................
00482001   1/1  larlglkvtlvergdrlggtl.................................................
00384681   1/1  paGldaAlylarlgakkvtlverrdrlg..........................................
00469721   1/1  rlgakvtliergdrllglld..................................................
00455191   1/1  arlgakvtlierrdrllgtl..................................................
00483641   1/1  clyvgcllskalg.........................................................
00467611   1/1  pegakvtlvergdrllpcld..................................................
00529641   1/1  vaksvtllersdelggpw....................................................
00445591   1/1  ----------------------------------------------------------------------
00454811   1/1  ----------------------------------------------------------------------
00419401   1/1  lrrlgaevtliergdrllpll.................................................
00481081   1/1  GgGyiGlelAaalarllpelgaeVtlvergdrl.......------------------------------
00406191   1/1  rVvviGaGpaGldaArellkdldlllktdisdnaleallarlgaevtvvgRrgpliaaftlkelerlpel
00480161   1/1  ----------------------------------------------------------------------
00423421   1/1  ----------------------------------------------------------------------
00469731   1/1  arlgaevtlvergdrll....pyldcelskall.....................................
00479921   1/1  ----------------------------------------------------------------------
00472761   1/1  ----------------------------------------------------------------------
00463441   1/1  aGleaAealarrGheVtlvealdrlggll.........................................
00360161   1/1  ----------------------------------------------------------------------
00457972   2/2  ----------------------------------------------------------------------
00504431   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           RERCEQWSARGAPVRVLDADETASYIGSTAYSGALLDSRAGTIQPLAYVRGLAGAALKAGVRLHTASPVN
00465791   1/1  diglllelaealrrlgvpvellspeelkellplldfpeflgglytprggtvdpaelvralleaaeelGve
00487711   1/1  lellrelaealralgvdvelldaaelraleplldlpdllgglyvpdggvvdpaalaaalaraaealGvei
00460571   1/1  aela.....dalllalgapprlldapelrellp.......vvvpgggvvdpaallealaeaaeelGveir
00464461   1/1  .leadavllatGarprllpipgld.......llggrvvvigggviglelaralaeaaeelgveillgtrv
00529111   1/1  llelleelgipfdpe.....................................................gp
00462701   1/1  dea....leadalllatGarprllpipgld.......llgglvvvigggviglelaralaeaaeelgvei
00491501   1/1  a.arlvrlldgleleadalilatGarprlllpipgldlfgvlgrvllssdlllgllllgkrvvviGggai
00470221   1/1  aldpdalevlledleelradavvlAtGsrprlppipgedlggvlhsallldllgkrvvvigggasgldla
00374411   1/1  fevlladgeeleadalilatGarprllpipgfdgkgvltardlldllflgkrvvviGggvsglelaeala
00492221   1/1  .........................................llpgggvvdpaellralaealaeelgvei
00490031   1/1  ...eadalllatGapprlldipgld.......llggrvvvigggvdglelaralaeaaeelgveillgtr
00396641   1/1  ...............ilatgappavleleglgvpflrtsdgaldlkgglvavigggsiarela..laeaa
00483561   1/1  ldalpkrlavl.....gggllgvdelaellpllgsevtgglrsprggtvdparlvralaeaaeelGveil
00359891   1/1  leadalllatGapprlldipgldelggllsldalggrvvvigggviglelaralleaaeelpgveillgt
00520321   1/1  lpipglelfgvrgl.ltlldalkleplllssdlaggllypgkrvvvigggaillealaeaaeelGveilt
00457951   1/1  ledadelarl.......gkrvavlgggel...lladgvtgglr.pdggrvdparlvrallealeelGvei
00523131   1/1  ...........................................ggvdrarlaaalaeaaealgveirlgt
00529261   1/1  ipgalldagfpydgllfvfgg.......................................gfigledarg
00484941   1/1  vlpdgkvlgyd......lglgalpdspealgleefpgrvvvigggyiglelagkrvrvggakvtllqrrp
00458811   1/1  ...........glsaingvvlergsaedydalipatgaedflgglflpaegilgatgsepfllpgvsllr
00526001   1/1  lavprgrvlggssvingavylradaidfatgargipgwdldgvlpyfdrledslgvlglpflgkrvvviG
00360921   1/1  inagvylrvspadfdel.gawgvtlddlepyfelaadalvlatGsrprlpplpglelggvlltaaealgl
00435771   1/1  aladgllleadavilAtGarprlppipgldlkgvltsrdlldllgkrvvviGgGasgldiaealarlgae
00413411   1/1  atgarpripplpglgvpg.vltsdgalalrepgkrvvviggglsglellvgrgdgaalaralaeaaealg
00465141   1/1  ............................lppldglllpgvgdvlgaelaaalaealeelgveillgtrvt
00400351   1/1  avvlatgadprllgipgldydfllpgvhsaedalgldllgkrvvviGggysgvelaealarlgapvtlld
00455181   1/1  ............................lpglgglflprggrvdgaelaaalaeaaeelgveillgtrvt
00476821   1/1  inggvlvrglpedfdalglgwsyeellpyfkkaekllgvlgalr.....................kllvv
00400491   1/1  .aleadalllatGarpr.lgipg.sdlpgvllalgkrvvvvgggviglelaaalaealealpgveillgt
00458701   1/1  kllvltsdlnalllelradalilatgalprlppipgldlgevlhsagyeellrrlgldllgkrvvviggg
00503631   1/1  .....................................glpppggggvdraelldylleaaerlgvedvir
00468341   1/1  ......................................lalrllgpdvtggerrpragvvdraellrall
00406021   1/1  ........................................ggrvvvigggvialeeaaeelgveiltgte
00380741   1/1  ...............................evllglllllgrggadgaelaaalaelleelgvevllgt
00470291   1/1  rllfprgkvlGGsssinggvylrgskndfdlwaglaglegws..ydellpyfkkaekliiatgsrpllpd
00461281   1/1  vlggsslingmvylrglpedldelakllgvegw.gyd.ellpyfkvae..dglgltadaiiiatgsrpry
00424461   1/1  ...................................................................pip
00364591   1/1  .........................................................gipggvlpeelve
00475641   1/1  ....................................................llrllaelaeklgveill
00477121   1/1  ........dallargvpldglvvvdgggrlaldfael.algapgyvvdraellralleaaeelgveirlg
00486071   1/1  ...........................................greellrylaealeklgveirlgtalf
00363001   1/1  .......................................ggrldpeelvlalaelleelgvevrlgtevt
00376431   1/1  ........................................lrvlgaelaaalaealeelgvevllgtevt
00488071   1/1  ........................................................vdpaellealaela
00406881   1/1  .....................................plllrvlgaelaaalaealeelgveillgtav.
00472701   1/1  ........................................lrvlgpelaeylrelleklgveillgtrvt
00499901   1/1  eleadavvlatGalsllprlpdipgldlfsleellsalglldllgkrvvvigggasgvdlaellarlgar
00533211   1/1  .....lelaellarlgaevlrlllglltllergdrllp.....................ellralleale
00529631   1/1  ..........................ldelleeglsplypglrldvpkelygfpdfplpgwfpvfpgrke
00368891   1/1  ...................................................................pel
00406601   1/1  aeallaelgvlfpigyaellpfyerleklygvlgegylpdlpgasifkglpvhssfddreldldgkrvvv
00467601   1/1  ........................................................daelaaalaellek
00471331   1/1  ..........lelaelleelgvevtllellggdrvlprldldg...............pellkalleale
00444131   1/1  grvvfpdgkvlkvptnlaellksfllglsekrrllaflgviatgdrpralgipgldlddlslfellerfl
00470681   1/1  .....................................llvaagdldaeelvlalaelleelgvevllgtr
00483651   1/1  ......................................................................
00462741   1/1  ngveyiegrasfldagkwevlte.dgwgifeeeltadaviiatGarpripdlipglgggvltsddyldle
00485831   1/1  ............................................lllllrrllllllllaagvegllill
00471411   1/1  ..........................................falpaelldalaelaeklgveirlgtev
00481991   1/1  velllgglgldlaellerkdavv...............................................
00501481   1/1  ..........................................llgilgeellarlreqleklgveillgt
00480451   1/1  ..................................................................pela
00488661   1/1  ....................................................................ee
00509611   1/1  .................................................................pelsk
00533221   1/1  ...................................................................eel
00480091   1/1  ...................................................................eel
00464161   1/1  lelllelldalv.....................................eelaaalaealeelgveillg
00440981   1/1  ................................................gaelveallelleelgveillg
00475651   1/1  ....................................................................pe
00366541   1/1  ......................................................................
00447051   1/1  ......................................................................
00472711   1/1  ....................................................................dl
00467501   1/1  ...............................................llaelllrllelllklgvevllg
00509271   1/1  ....................................llggvpsglllgaalllallelleklgveillgt
00461561   1/1  .............................................frlpkelldrlielleelgveirln
00496791   1/1  ................................................................pelley
00384491   1/1  ................................................................dcilsk
00509601   1/1  ............................................deelaeylrelleklgvevllgtevt
00473271   1/1  r...gdedlleakalllatgpylpllpglsleevldsllgldllpklvlvigggviglelaellarlgae
00479091   1/1  ...........................................................pelallllell
00457971   1/2  ----------------------------------------------------------------------
00382851   1/1  ......................................................................
00485841   1/1  ..........................................................pelsklllelle
00503641   1/1  .........................................................gipypplgkelld
00488651   1/1  ..........................................glldaeelaeylrelleklgvevllgte
00363011   1/1  ......................................................................
00482001   1/1  ...................................................................dpe
00384681   1/1  ......................................................................
00469721   1/1  ..................................................................pels
00455191   1/1  ..................................................................dpel
00483641   1/1  .........................................llglldeelalrllelleklgvelllgte
00467611   1/1  ..................................................................pels
00529641   1/1  ......................................................................
00445591   1/1  ----------------------------------------------------------------------
00454811   1/1  ----------------------------------------------------------------------
00419401   1/1  ...................................................................dee
00481081   1/1  ----------------------------------------------------------------------
00406191   1/1  ggllrygipedkllkeflareiadl.............................................
00480161   1/1  ----------------------------------------------------------------------
00423421   1/1  ----------------------------------------------------------------------
00469731   1/1  ......................................................................
00479921   1/1  ----------------------------------------------------------------------
00472761   1/1  ----------------------------------------------------------------------
00463441   1/1  ......................................................................
00360161   1/1  ----------------------------------------------------------------------
00457972   2/2  ---------aglkvlliekgrlgglllllayggillrvgfiplkrlaelleallelaeklgveillgtev
00504431   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           ETGRNGAKWVVKTPEGSVTAKWIVVATEAYSTGPWQIIREEQVYLPYFNFATRPLSDNLQKSILPGRQGC
00465791   1/1  illgtevtsierdgdgvtVttedGtiradlvvlAtGawgsp.llkllglplepvrgqilvleplpe.vlp
00487711   1/1  rlgtevtgierdggrvtgVrtadGeieadlvvlAaGawsnellellglelpp..................
00460571   1/1  lg.rvtsi..dG.........etleadlvvlatGagsrellg..dlglepvrggfivvdpp.........
00464461   1/1  teilvdeggrvtgvttedadGeeltiradavvlatGgfpn.lalllglg...lp................
00529111   1/1  gggtvdgaalvralaeaaleelgveirlgteVtdilvdgggvlwtvrvtGVvvndtgvaldgllkllvdp
00462701   1/1  llgtrvteilvdeggrvtgvtlrdadGeevtiradavvlatGglsnlrlll....glglPi..f...P..
00491501   1/1  glelalalarlgae.vtlversprlgpvlpaglsealaealeallGveirlgtrvteierdgggvtvtte
00470221   1/1  ellarlgaevtvvlerrdrlllffppdgqvdpaglvralaealeallgveirlgtrvteierdgggvtVt
00374411   1/1  rllkilgaevtllersd.........rllalldd.egqvdprglldalaealeellgveirlgtrvteie
00492221   1/1  rlgtevtdilrdggrvtgvttedllvdkngv---------------------------------------
00490031   1/1  vtellvdeggrvtgvvledadGeevtiradavvlatGgfpn.lrrllgldlpllpvrgtalalgatgdgl
00396641   1/1  lklgveilegtevtellgdgdgkgrvtgvvtkdlktgevgtiradavvlatGgagnlllllsvlepdlrt
00483561   1/1  lgtevtsierdggvvgVttedGeiradlvvlA--------------------------------------
00359891   1/1  evteilgdgdgvtvttgrvtgvvlrdladGeevtiradlvvlatGarsnlllll................
00520321   1/1  gtevteierdggrvtgVtvrdtadGeeetiradlvvlatGarsnvrl..lglsglglpgdgyalairvge
00457951   1/1  llg.evteierdg........dGe..adlvv---------------------------------------
00523131   1/1  evtdllleggrvtgVrtadGetlradavvlAtGafsrlllllglelpvgptlgyalvtdllellgkrvvv
00529261   1/1  llrlgagvtvvdrgdllralaeaaeelGveirlgteVtsierdedgrvtgVttedmeplkdGeekpvpve
00484941   1/1  pfvlpllllglllllllllglspdhligagpl--------------------------------------
00458811   1/1  vldsagalslafrgkrvvvrltyddnyfndeyqglpereklltlviiGgGndpgklaralaealekrlGv
00526001   1/1  ggpigvefaealarlgakvtl.............vergglllpgdgvgdraslaralleaaealgveilt
00360921   1/1  dflgkrvvvigggasgvelasalarlgagvtvvyrpdgg..rgalaralaraaeaagvtvltgtrvteie
00435771   1/1  vtvverrprllalldalalllgllsldalaalepllalellggllypdgg...paalvealaeal.e.gv
00413411   1/1  veiltgtevteilrdeggrvtgVvtadtkdGeevtiradavvlatGafsn.lrlllglglgltgdglala
00465141   1/1  ei..dggvvgvttedgetieadavvlAtGars......................................
00400351   1/1  rsplarlpp......gllspgdglldggdgalvaalaealerlgveillgtrvteilrdgggvtgVtted
00455181   1/1  .i..dggvvgvttdgetiradavilAtGalslplll..................................
00476821   1/1  igggaiglglalvldrlgakvtgvgrldrg----------------------------------------
00400491   1/1  evtellgdggrvtgvvledgetgeevtiradavvlatGgrpnlellltnppgntgdglalleraglel..
00458701   1/1  asavela.alaragasvtlllrsprlglltprggygalvealakalendylealarlgveirlgtrvtei
00503631   1/1  lgtevtsidfdedgvvvgvttedGeti-------------------------------------------
00468341   1/1  eaaeelGngrveirlgtrvtsierdgelledleeypvtvtlenlseeeakpeelggkvagvllrklledg
00406021   1/1  vtei..dg.vvgvvledGeeltieadlvvlatGarsnlrl..............................
00380741   1/1  avt.i.ddgr...VtldgetitadavilAtGarprll.................................
00470291   1/1  lpgglllggdgiltselalsldllpklvvvig--------------------------------------
00461281   1/1  pgipgplsvswaldldelpkrlvvigggaig---------------------------------------
00424461   1/1  grvlpkellealaealeklgveillgtevt----------------------------------------
00364591   1/1  alaelleklgveirlgtrvt....dg..vgvtte------------------------------------
00475641   1/1  gtavtellkddggvvvtgdgetiradavilAt--------------------------------------
00477121   1/1  trvtsileedgdgvtvtledggeeetieadlvvgAdGarsrvrrllgip.....................
00486071   1/1  vdpnrVts.......vtvttedGetgelvpgetiradavvl-----------------------------
00363001   1/1  sidrdgdgvtledge.tleadavvlAtGarprvlll..................................
00376431   1/1  sidrdgggvtgvllvttgdgetiradavvlAtGar...................................
00488071   1/1  eelgveirlgtrv.............Ddgetira------------------------------------
00406881   1/1  .ve.dggrvtl..dgetieadlvvlAtGarsllll...................................
00472701   1/1  sidrdgdtgrvtgvtledgetleadav-------------------------------------------
00499901   1/1  vtllerldgll.lpgdgvldpkgglgallealleelgveillgtpvtei.............Geleadav
00533211   1/1  elgveirlgt.vtei..dggvvgvtle-------------------------------------------
00529631   1/1  lldyladlaeklgveirlnteVtsverdgdgv--------------------------------------
00368891   1/1  aaallelleklgvevllgtevtaidv--------------------------------------------
00406601   1/1  igsgasavrakavviatGareralpapgldllgrspagalpllsrrf-----------------------
00467601   1/1  lgvevllgt.vteiegddgrvtgvvvvrledgetleadlvilatGglsllll..................
00471331   1/1  klgv.illgt.veil.gddggvgvtledGeeetiead---------------------------------
00444131   1/1  lldllpklllilgggliglepaelsarlglkv--------------------------------------
00470681   1/1  vtgidpdg..vtvtladgetitadklv-------------------------------------------
00483651   1/1  ....deelalallelleklgvelllgt-------------------------------------------
00462741   1/1  d...lpgklvdfvllalalaiaviGggasglelasa----------------------------------
00485831   1/1  gvevvvgvadgggvtvvtgdgetiradavilA--------------------------------------
00471411   1/1  .....dg..vtvttedgetieadavvlAtG----------------------------------------
00481991   1/1  ................dgeelaaalaelleelgvevllgtav.ii..ddgtvtv..dgetieadlvilAt
00501481   1/1  rvtsidl.dggtvvltdgetieadavilAtG.......................................
00480451   1/1  aallelleklgvelllgtrvtaidldgg------------------------------------------
00488661   1/1  laaallelleklgvevllgtrvtaidvd------------------------------------------
00509611   1/1  allelleklgvelllgtevteidgd..-------------------------------------------
00533221   1/1  slallelleklgvelllgtrvtaidvdg------------------------------------------
00480091   1/1  sllllelleklgvelllgtrvtaidvdg------------------------------------------
00464161   1/1  tevt.i.edgrv.gvtledgeeltleadlvilatGrrsl.Plllpntellgleklgvelder........
00440981   1/1  tevtsidldgggv.vltdgetieadavvlAtGarprllglpgldlpggl.....................
00475651   1/1  lskallelleklgvelllgtevtaid--------------------------------------------
00366541   1/1  pelskallelleklgvevllgtevtai-------------------------------------------
00447051   1/1  dlllelleklgveillgtevteiegdg-------------------------------------------
00472711   1/1  llelleklgveillgtevteidgdggg-------------------------------------------
00467501   1/1  .evtsidpdg..ktvtledgetleydl-------------------------------------------
00509271   1/1  evtsidld..ggtvvgvttgdgetlta-------------------------------------------
00461561   1/1  tev........gkdvtledllleydav-------------------------------------------
00496791   1/1  llelleklgveillgtevteiegdgdgv------------------------------------------
00384491   1/1  allelleelgvevllgtevteveldggg------------------------------------------
00509601   1/1  sidgdgkg..vtlddgeleadavvlat-------------------------------------------
00473271   1/1  vtvlergdgllgggdgqiyprggagallea----------------------------------------
00479091   1/1  eklgvevllgtrvteiakeylpelllgveveagdg-----------------------------------
00457971   1/2  ----------------------------------------------------------------------
00382851   1/1  ......elleelgvelllgtkvtsieg-------------------------------------------
00485841   1/1  klgvdlllgtkvtaidrdgdgvtvvlllk-----------------------------------------
00503641   1/1  yleeyarklglrirfgtevtsvdrdg.-------------------------------------------
00488651   1/1  vtsidgdgkg..vtledgetleadlvv-------------------------------------------
00363011   1/1  .....rpelskallelleelgvelrlgt------------------------------------------
00482001   1/1  lsklllelleklgvevllgtevtaiegd------------------------------------------
00384681   1/1  ........fpafpelvellkeegveil-------------------------------------------
00469721   1/1  kallelleklgvelllgtevtaidldgd------------------------------------------
00455191   1/1  skallelleklgvevllgtevteidg.-------------------------------------------
00483641   1/1  vtsidlegktvtllllvlgdgetleyd-------------------------------------------
00467611   1/1  klllelleklgvdvllgtevtaidvddkt-----------------------------------------
00529641   1/1  ........lgvvillnteveevtgdg--------------------------------------------
00445591   1/1  ----------------------------------------------------------------------
00454811   1/1  ----------------------------------------------------------------------
00419401   1/1  lsllleelleelgidvllgtevteie--------------------------------------------
00481081   1/1  ----------------------------------------------------------------------
00406191   1/1  .............................-----------------------------------------
00480161   1/1  ----------------------------------------------------------------------
00423421   1/1  ----------------------------------------------------------------------
00469731   1/1  .....elleklgvdlllgtkvtaidrdd------------------------------------------
00479921   1/1  ----------------------------------------------------------------------
00472761   1/1  ----------------------------------------------------------------------
00463441   1/1  .....rlgipdpllerleelgveillgvavt---------------------------------------
00360161   1/1  ----------------------------------------------------------------------
00457972   2/2  tdidldddvvvvltdgetitltadavv-------------------------------------------
00504431   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           WDTKEILSSFRMDKAGRLVFGSVGALRGTGTAIHRAWAKRSLKRLFPQLGDTEFECEWYGQIGMTDNAVP
00465791   1/1  vvlaigdgvf..............gglllggtveldgldpdlspedeeell.el----------------
00487711   1/1  ......................................................................
00460571   1/1  ........................................................dpeilrrwvglrpl
00464461   1/1  ..p....hP.............dgrllfgprd............d..dellrllpglgvaliarytaggi
00529111   1/1  llllkllldletgegetirAkavilAtGaysrllpll..pdlpgles-----------------------
00462701   1/1  ............................dgrlllgprp............d..delrellpglgvaldeh
00491501   1/1  dGdgeeetieadavvlatGarpllrll....edlglp.................................
00470221   1/1  tadGetieadlvvlatGarsllrll.......glpglgleldpa..........................
00374411   1/1  rdgggvtvtledgdgeeetieadlvvlatGarsltellgl..............................
00492221   1/1  ----------------------------------------------------------------------
00490031   1/1  allerag...........velddrgfvqf.........................fPtllgivvde..tlr
00396641   1/1  tnpptntgdglalalraglelaglelfvqfhptglitepvrg............................
00483561   1/1  ----------------------------------------------------------------------
00359891   1/1  ......................................................................
00520321   1/1  plpdhl................................................................
00457951   1/1  ----------------------------------------------------------------------
00523131   1/1  vgggktgtelaldlrsiga.svtlfqpgdrllppfspelaaallralleqlpgv....ltltnagveeii
00529261   1/1  GetiradlvvlAtGarssprlllleglgledgrgyi..................................
00484941   1/1  ----------------------------------------------------------------------
00458811   1/1  eirlgtevteierdeggrvtvttedgetkdvlgeeeeieadlvvlaaGarpstrllllsgigleldprgy
00526001   1/1  gtrvteilrdedggrvtgVetrdladGeeftiradlVvlaaGaipsprllllsGiglpevgrilvdhpgg
00360921   1/1  rdggggrvtgVtledgegltgeevtiradlvvlaaGarsttrllllsglglplppdlgvvgrnp......
00435771   1/1  eillgtrvteierdgggvtvttedadgslkpvledgetieadavvlatGarslar.llldpplppvrgqa
00413411   1/1  lrlgap.....lpdggflqfhPt...............................................
00465141   1/1  ..................................lllllgrrpntellglegaglelderggivvdetlr
00400351   1/1  geleldgeevtiradavvlatGarssprllllsgigpaellkalgielpldlpgvgenlidhptgglla.
00455181   1/1  ........................................glspntpgllleglgielderggivvdenl
00476821   1/1  ----------------------------------------------------------------------
00400491   1/1  ......................................................................
00458701   1/1  lrdgggvtvttadGetieadavvlatgarplaellgllgpelpergiiavdglp..vgsllkvhlg....
00503631   1/1  ----------------------------------------------------------------------
00468341   1/1  ddgrvtvttedldtgGeeetiradlvvlAtGarsllrkllglelpgggv.....................
00406021   1/1  ...........................................llgldlpkelleglgleldtrggivvd
00380741   1/1  ..............................................................glpgitpt
00470291   1/1  ----------------------------------------------------------------------
00461281   1/1  ----------------------------------------------------------------------
00424461   1/1  ----------------------------------------------------------------------
00364591   1/1  ----------------------------------------------------------------------
00475641   1/1  ----------------------------------------------------------------------
00477121   1/1  ......................................................................
00486071   1/1  ----------------------------------------------------------------------
00363001   1/1  .....................................................................p
00376431   1/1  ......................................................................
00488071   1/1  ----------------------------------------------------------------------
00406881   1/1  ...........................................................grrpntellll
00472701   1/1  ----------------------------------------------------------------------
00499901   1/1  vlatgldplael..lgle...lpergl...........................................
00533211   1/1  ----------------------------------------------------------------------
00529631   1/1  ----------------------------------------------------------------------
00368891   1/1  ----------------------------------------------------------------------
00406601   1/1  ----------------------------------------------------------------------
00467601   1/1  ......................................................................
00471331   1/1  ----------------------------------------------------------------------
00444131   1/1  ----------------------------------------------------------------------
00470681   1/1  ----------------------------------------------------------------------
00483651   1/1  ----------------------------------------------------------------------
00462741   1/1  ----------------------------------------------------------------------
00485831   1/1  ----------------------------------------------------------------------
00471411   1/1  ----------------------------------------------------------------------
00481991   1/1  Garprlp.plpg..........................................................
00501481   1/1  ............................................................vlvaigrrpn
00480451   1/1  ----------------------------------------------------------------------
00488661   1/1  ----------------------------------------------------------------------
00509611   1/1  ----------------------------------------------------------------------
00533221   1/1  ----------------------------------------------------------------------
00480091   1/1  ----------------------------------------------------------------------
00464161   1/1  ......................................................................
00440981   1/1  .............................................................ealglelde
00475651   1/1  ----------------------------------------------------------------------
00366541   1/1  ----------------------------------------------------------------------
00447051   1/1  ----------------------------------------------------------------------
00472711   1/1  ----------------------------------------------------------------------
00467501   1/1  ----------------------------------------------------------------------
00509271   1/1  ----------------------------------------------------------------------
00461561   1/1  ----------------------------------------------------------------------
00496791   1/1  ----------------------------------------------------------------------
00384491   1/1  ----------------------------------------------------------------------
00509601   1/1  ----------------------------------------------------------------------
00473271   1/1  ----------------------------------------------------------------------
00479091   1/1  ----------------------------------------------------------------------
00457971   1/2  ----------------------------------------------------------------------
00382851   1/1  ----------------------------------------------------------------------
00485841   1/1  ----------------------------------------------------------------------
00503641   1/1  ----------------------------------------------------------------------
00488651   1/1  ----------------------------------------------------------------------
00363011   1/1  ----------------------------------------------------------------------
00482001   1/1  ----------------------------------------------------------------------
00384681   1/1  ----------------------------------------------------------------------
00469721   1/1  ----------------------------------------------------------------------
00455191   1/1  ----------------------------------------------------------------------
00483641   1/1  ----------------------------------------------------------------------
00467611   1/1  ----------------------------------------------------------------------
00529641   1/1  ----------------------------------------------------------------------
00445591   1/1  ----------------------------------------------------------------------
00454811   1/1  ----------------------------------------------------------------------
00419401   1/1  ----------------------------------------------------------------------
00481081   1/1  ----------------------------------------------------------------------
00406191   1/1  ----------------------------------------------------------------------
00480161   1/1  ----------------------------------------------------------------------
00423421   1/1  ----------------------------------------------------------------------
00469731   1/1  ----------------------------------------------------------------------
00479921   1/1  ----------------------------------------------------------------------
00472761   1/1  ----------------------------------------------------------------------
00463441   1/1  ----------------------------------------------------------------------
00360161   1/1  ----------------------------------------------------------------------
00457972   2/2  ----------------------------------------------------------------------
00504431   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           RFHKFAENVIGFSGYNGRGIAPGTAFGKVIAQHILGEIAEADLPLPVTEPKAQAFRAVKEAYYEAGAQIA
00465791   1/1  ----------------------------------------------------------------------
00487711   1/1  .pdglpvigpvtgvpglylagga...Gvtlapasgrlladlilgglppldl-------------------
00460571   1/1  tpdglplrtp.vpglylagdhggqgvtlalasgrlaaelllgg---------------------------
00464461   1/1  pvdpdgrpllg.rltsvpglyaaGdaaggvhganglgg--------------------------------
00529111   1/1  ----------------------------------------------------------------------
00462701   1/1  ywaggipvdpdgrplrgllrtsvpglyaaGdaasvvhpan------------------------------
00491501   1/1  .................................eplrpal------------------------------
00470221   1/1  ..............................gerlpdg.........Wgggipvdpd--------------
00374411   1/1  ........................................------------------------------
00492221   1/1  ----------------------------------------------------------------------
00490031   1/1  ..tsvpglyaaGdaagglhganglggnglalalasGrlaa------------------------------
00396641   1/1  ...............................................................-------
00483561   1/1  ----------------------------------------------------------------------
00359891   1/1  .....lsgigptgdglalleraglelvderggivvdeglrtsvpglyaa---------------------
00520321   1/1  ............................pggivvdetlr-------------------------------
00457951   1/1  ----------------------------------------------------------------------
00523131   1/1  rd--------------------------------------------------------------------
00529261   1/1  ........................................------------------------------
00484941   1/1  ----------------------------------------------------------------------
00458811   1/1  ivg..................................---------------------------------
00526001   1/1  gvlilp......................................--------------------------
00360921   1/1  .......................................-------------------------------
00435771   1/1  lptlplgldtkggllvderlrtsv..................----------------------------
00413411   1/1  ...hytmggivvdpdlr....tsvpglyaaGdaagpglhganplggngl---------------------
00465141   1/1  t....svpglyaaGdaagg.gglvatAiasGrlaaeaiagylkg--------------------------
00400351   1/1  .............................................-------------------------
00455181   1/1  rtsvpgly..aaGdvagggngvavaiasGrlaaeaiagylkgld--------------------------
00476821   1/1  ----------------------------------------------------------------------
00400491   1/1  .............................hdtrggivvdetlrtsvpglyaaGdvagt------------
00458701   1/1  ...........................................---------------------------
00503631   1/1  ----------------------------------------------------------------------
00468341   1/1  .............................................-------------------------
00406021   1/1  etlrt....svpglyaaGdaagp.gqgvatalasGrlaaeai----------------------------
00380741   1/1  llleaagvelderggivvdetlrtsvpglyaaGdvagggrlavv--------------------------
00470291   1/1  ----------------------------------------------------------------------
00461281   1/1  ----------------------------------------------------------------------
00424461   1/1  ----------------------------------------------------------------------
00364591   1/1  ----------------------------------------------------------------------
00475641   1/1  ----------------------------------------------------------------------
00477121   1/1  ...........prtsvgrvflaGDaahavhplggqG----------------------------------
00486071   1/1  ----------------------------------------------------------------------
00363001   1/1  glellegagleldggivvdeylrtsvpgvyaaGdvag---------------------------------
00376431   1/1  ...........pntplleglglelderggivvdetlrtsvpgly--------------------------
00488071   1/1  ----------------------------------------------------------------------
00406881   1/1  elagleld.rggivvdetlrtsvpgvyaaGdaagg.grgaav----------------------------
00472701   1/1  ----------------------------------------------------------------------
00499901   1/1  .......................................ivvdpglr...t-------------------
00533211   1/1  ----------------------------------------------------------------------
00529631   1/1  ----------------------------------------------------------------------
00368891   1/1  ----------------------------------------------------------------------
00406601   1/1  ----------------------------------------------------------------------
00467601   1/1  .....lgrrpntellgleaaglelderggivvdetlrtsvpgi---------------------------
00471331   1/1  ----------------------------------------------------------------------
00444131   1/1  ----------------------------------------------------------------------
00470681   1/1  ----------------------------------------------------------------------
00483651   1/1  ----------------------------------------------------------------------
00462741   1/1  ----------------------------------------------------------------------
00485831   1/1  ----------------------------------------------------------------------
00471411   1/1  ----------------------------------------------------------------------
00481991   1/1  .......................................grr----------------------------
00501481   1/1  tellklglelderggivvdelllrtsvpgvfaaGdvaggpl-----------------------------
00480451   1/1  ----------------------------------------------------------------------
00488661   1/1  ----------------------------------------------------------------------
00509611   1/1  ----------------------------------------------------------------------
00533221   1/1  ----------------------------------------------------------------------
00480091   1/1  ----------------------------------------------------------------------
00464161   1/1  .................ggilvdetlrtsvpglyaaGdvagg----------------------------
00440981   1/1  rggivvdetlrtsvpglyaaGdvaggpgplavtAlasGrla-----------------------------
00475651   1/1  ----------------------------------------------------------------------
00366541   1/1  ----------------------------------------------------------------------
00447051   1/1  ----------------------------------------------------------------------
00472711   1/1  ----------------------------------------------------------------------
00467501   1/1  ----------------------------------------------------------------------
00509271   1/1  ----------------------------------------------------------------------
00461561   1/1  ----------------------------------------------------------------------
00496791   1/1  ----------------------------------------------------------------------
00384491   1/1  ----------------------------------------------------------------------
00509601   1/1  ----------------------------------------------------------------------
00473271   1/1  ----------------------------------------------------------------------
00479091   1/1  ----------------------------------------------------------------------
00457971   1/2  ----------------------------------------------------------------------
00382851   1/1  ----------------------------------------------------------------------
00485841   1/1  ----------------------------------------------------------------------
00503641   1/1  ----------------------------------------------------------------------
00488651   1/1  ----------------------------------------------------------------------
00363011   1/1  ----------------------------------------------------------------------
00482001   1/1  ----------------------------------------------------------------------
00384681   1/1  ----------------------------------------------------------------------
00469721   1/1  ----------------------------------------------------------------------
00455191   1/1  ----------------------------------------------------------------------
00483641   1/1  ----------------------------------------------------------------------
00467611   1/1  ----------------------------------------------------------------------
00529641   1/1  ----------------------------------------------------------------------
00445591   1/1  ----------------------------------------------------------------------
00454811   1/1  ----------------------------------------------------------------------
00419401   1/1  ----------------------------------------------------------------------
00481081   1/1  ----------------------------------------------------------------------
00406191   1/1  ----------------------------------------------------------------------
00480161   1/1  ----------------------------------------------------------------------
00423421   1/1  ----------------------------------------------------------------------
00469731   1/1  ----------------------------------------------------------------------
00479921   1/1  ----------------------------------------------------------------------
00472761   1/1  ----------------------------------------------------------------------
00463441   1/1  ----------------------------------------------------------------------
00360161   1/1  ----------------------------------------------------------------------
00457972   2/2  ----------------------------------------------------------------------
00504431   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           HFAGERF---------------------------------------------------------------
00465791   1/1  ----------------------------------------------------------------------
00487711   1/1  ----------------------------------------------------------------------
00460571   1/1  ----------------------------------------------------------------------
00464461   1/1  ----------------------------------------------------------------------
00529111   1/1  ----------------------------------------------------------------------
00462701   1/1  ----------------------------------------------------------------------
00491501   1/1  ----------------------------------------------------------------------
00470221   1/1  ----------------------------------------------------------------------
00374411   1/1  ----------------------------------------------------------------------
00492221   1/1  ----------------------------------------------------------------------
00490031   1/1  ----------------------------------------------------------------------
00396641   1/1  ----------------------------------------------------------------------
00483561   1/1  ----------------------------------------------------------------------
00359891   1/1  ----------------------------------------------------------------------
00520321   1/1  ----------------------------------------------------------------------
00457951   1/1  ----------------------------------------------------------------------
00523131   1/1  ----------------------------------------------------------------------
00529261   1/1  ----------------------------------------------------------------------
00484941   1/1  ----------------------------------------------------------------------
00458811   1/1  ----------------------------------------------------------------------
00526001   1/1  ----------------------------------------------------------------------
00360921   1/1  ----------------------------------------------------------------------
00435771   1/1  ----------------------------------------------------------------------
00413411   1/1  ----------------------------------------------------------------------
00465141   1/1  ----------------------------------------------------------------------
00400351   1/1  ----------------------------------------------------------------------
00455181   1/1  ----------------------------------------------------------------------
00476821   1/1  ----------------------------------------------------------------------
00400491   1/1  ----------------------------------------------------------------------
00458701   1/1  ----------------------------------------------------------------------
00503631   1/1  ----------------------------------------------------------------------
00468341   1/1  ----------------------------------------------------------------------
00406021   1/1  ----------------------------------------------------------------------
00380741   1/1  ----------------------------------------------------------------------
00470291   1/1  ----------------------------------------------------------------------
00461281   1/1  ----------------------------------------------------------------------
00424461   1/1  ----------------------------------------------------------------------
00364591   1/1  ----------------------------------------------------------------------
00475641   1/1  ----------------------------------------------------------------------
00477121   1/1  ----------------------------------------------------------------------
00486071   1/1  ----------------------------------------------------------------------
00363001   1/1  ----------------------------------------------------------------------
00376431   1/1  ----------------------------------------------------------------------
00488071   1/1  ----------------------------------------------------------------------
00406881   1/1  ----------------------------------------------------------------------
00472701   1/1  ----------------------------------------------------------------------
00499901   1/1  ----------------------------------------------------------------------
00533211   1/1  ----------------------------------------------------------------------
00529631   1/1  ----------------------------------------------------------------------
00368891   1/1  ----------------------------------------------------------------------
00406601   1/1  ----------------------------------------------------------------------
00467601   1/1  ----------------------------------------------------------------------
00471331   1/1  ----------------------------------------------------------------------
00444131   1/1  ----------------------------------------------------------------------
00470681   1/1  ----------------------------------------------------------------------
00483651   1/1  ----------------------------------------------------------------------
00462741   1/1  ----------------------------------------------------------------------
00485831   1/1  ----------------------------------------------------------------------
00471411   1/1  ----------------------------------------------------------------------
00481991   1/1  ----------------------------------------------------------------------
00501481   1/1  ----------------------------------------------------------------------
00480451   1/1  ----------------------------------------------------------------------
00488661   1/1  ----------------------------------------------------------------------
00509611   1/1  ----------------------------------------------------------------------
00533221   1/1  ----------------------------------------------------------------------
00480091   1/1  ----------------------------------------------------------------------
00464161   1/1  ----------------------------------------------------------------------
00440981   1/1  ----------------------------------------------------------------------
00475651   1/1  ----------------------------------------------------------------------
00366541   1/1  ----------------------------------------------------------------------
00447051   1/1  ----------------------------------------------------------------------
00472711   1/1  ----------------------------------------------------------------------
00467501   1/1  ----------------------------------------------------------------------
00509271   1/1  ----------------------------------------------------------------------
00461561   1/1  ----------------------------------------------------------------------
00496791   1/1  ----------------------------------------------------------------------
00384491   1/1  ----------------------------------------------------------------------
00509601   1/1  ----------------------------------------------------------------------
00473271   1/1  ----------------------------------------------------------------------
00479091   1/1  ----------------------------------------------------------------------
00457971   1/2  ----------------------------------------------------------------------
00382851   1/1  ----------------------------------------------------------------------
00485841   1/1  ----------------------------------------------------------------------
00503641   1/1  ----------------------------------------------------------------------
00488651   1/1  ----------------------------------------------------------------------
00363011   1/1  ----------------------------------------------------------------------
00482001   1/1  ----------------------------------------------------------------------
00384681   1/1  ----------------------------------------------------------------------
00469721   1/1  ----------------------------------------------------------------------
00455191   1/1  ----------------------------------------------------------------------
00483641   1/1  ----------------------------------------------------------------------
00467611   1/1  ----------------------------------------------------------------------
00529641   1/1  ----------------------------------------------------------------------
00445591   1/1  ----------------------------------------------------------------------
00454811   1/1  ----------------------------------------------------------------------
00419401   1/1  ----------------------------------------------------------------------
00481081   1/1  ----------------------------------------------------------------------
00406191   1/1  ----------------------------------------------------------------------
00480161   1/1  ----------------------------------------------------------------------
00423421   1/1  ----------------------------------------------------------------------
00469731   1/1  ----------------------------------------------------------------------
00479921   1/1  ----------------------------------------------------------------------
00472761   1/1  ----------------------------------------------------------------------
00463441   1/1  ----------------------------------------------------------------------
00360161   1/1  ----------------------------------------------------------------------
00457972   2/2  ----------------------------------------------------------------------
00504431   1/1  ----------------------------------------------------------------------