[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for atum0:AAK88515.1


[Show Plain Result]

## Summary of Sequence Search
   1::210
   2::210  8.4e-79 54.1% 0037360 00373601 1/1   rrin-8X methylmutase CbiC/CobH          
  11::207    3e-67 53.6% 0050101 00501011 1/1   rrin-8X methylmutase CbiC/CobH          
  17::209  2.1e-65 54.7% 0048647 00486471 1/1   rrin-8X methylmutase CbiC/CobH          
   1::210


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTDYDYIRDGNAIYERSFAIIREEADLSAFTEEQADIAIRMIHACGQVEAAGHFRFSPDFVSAARGALLA
00373601   1/1  -llleyildgaeieeesfaiideelglsllselelaivrrvihatgdfeladllrfspgaveagleaLka
00501011   1/1  ----------leieeesfeiireelglsglsplelavvrrvihatgdfeladllrfspgaveaglealka
00486471   1/1  ----------------sfeiireelgll.lsplelavvrrvihatgdfeladllrfspgaveaglealka


                         -         -         *         -         -         -         -:140
query           GKPVLCDAQMVAHGVTHARLPADNAVICTLRDPRTPELAKNIGNTRSAAALDLWADYLDGALVAIGNAPT
00373601   1/1  gapilvDvnmvaaGitrlrltlgnevlcllddpevaelakelgitrsaaglelaleeldgaivviGnAPt
00501011   1/1  gapiltDvnmvaaGitklllktlgnevlcllddpevaelakelgitrsaaalelaleeglldgaivviGn
00486471   1/1  gapiltDvnmvaaGitklrltlgnevlcllddpevaelakelgitrsaaalelaleeldgaivviGnAPt


                         +         -         -         -         -         *         -:210
query           ALFYLLEMLEKGGPRPAAIIGMPVGFVGAAESKDALEASALGIPYAIVKGRLGGSAMTAAAINAVARAGL
00373601   1/1  ALlellelieegklrPalvigvPvGFvgaaeskeaLlelslgvPlitveGrkGGsalaaaivnallllal
00501011   1/1  APtALlellelieeg.lrPalvigvPvGFvgaaeskeaLlel..gvPlitleGrkGGsalaaaivna---
00486471   1/1  ALlellelieegalrPalvigvPvGFvgaaeskeaLle..lgvPlivveGrkGGsalaaaivnalllll-