[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for bp441:AAQ81341.1


[Show Plain Result]

## Summary of Sequence Search
   1::439
  29::156  PF01443 0.0% 27.1739130434783  Viral (Superfamily 1) RNA helicase 
 386::438  PF01443 0.0% 27.0833333333333  Viral (Superfamily 1) RNA helicase 
  18::72   PF02562 0.0% 32.7272727272727  PhoH-like protein 
  33::131  PF05970 0.0% 30.4347826086957  PIF1 helicase 
 215::259  PF05970 0.0% 28.8888888888889  PIF1 helicase 
 390::407  PF05970 0.0% 38.8888888888889  PIF1 helicase 
  23::59   PF10412 0.0% 40.5405405405405  Type IV secretion-system coupling protein DNA-bindi 
   1::439


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLTYDDLTNGQKLAIDGAMDAISTKRHITIRGPAGTGKTTLTKFLLDRLFQTGQQGIVLAAPTHQAKKEL
PF01443         ----------------------------vvhGvpGcGKStlirkllrt.................ltvnr
PF01443         ----------------------------vvhGvpGcGKStlirkllrt.................ltvnr
PF02562         -----------------ylealkkndivfaiGpaGtGKTylavalavealkkkkvkriiltRpaveagee
PF05970         --------------------------------sggtgktflwkalikvlrs..egkivlvv....AssGi
PF05970         --------------------------------sggtgktflwkalikvlrs..egkivlvv....AssGi
PF05970         --------------------------------sggtgktflwkalikvlrs..egkivlvv....AssGi
PF10412         ----------------------setqhilivGttGtGKtqalrelldqirargdraiiy-----------


                         -         -         *         -         -         -         -:140
query           SKHALRKAYTIQSLLKINPSTLEENQIFEQKGTPDFSKIRVLICDEVSFYTRKLFNILMKTVPSHCVIIG
PF01443         ptaelrtegk.............pklpnlsvrtvds...flmalvks..kgkililDEylllhaGyilll
PF01443         ptaelrtegk.............pklpnlsvrtvds...flmalvks..kgkililDEylllhaGyilll
PF02562         lG--------------------------------------------------------------------
PF05970         AalllpgGrtahSrfkipl.kideeslckikrgsklaellekasliiwDEapmldrecfea---------
PF05970         AalllpgGrtahSrfkipl.kideeslckikrgsklaellekasliiwDEapmldrecfea---------
PF05970         AalllpgGrtahSrfkipl.kideeslckikrgsklaellekasliiwDEapmldrecfea---------
PF10412         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           IGDKAQIRGVSEDNETHELSPFFTDDRFSQVELDEVKRHQGPIIEVATDIRNGKWIYEKLDEHGNGVKQY
PF01443         aalssaklvil.fGDp------------------------------------------------------
PF01443         aalssaklvil.fGDp------------------------------------------------------
PF02562         ----------------------------------------------------------------------
PF05970         ----------------------------------------------------------------------
PF05970         ----------------------------------------------------------------------
PF05970         ----------------------------------------------------------------------
PF10412         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           HSVKDFLGVYFNRTKKPEDLFENRIMAYTNASVDKLNAVIRKKLYGSDVAPFLPGEILVMQEPLMFEIDV
PF01443         ----------------------------------------------------------------------
PF01443         ----------------------------------------------------------------------
PF02562         ----------------------------------------------------------------------
PF05970         ----evypdllankedkeflaerailapknedvdevNdsllkklegeek---------------------
PF05970         ----evypdllankedkeflaerailapknedvdevNdsllkklegeek---------------------
PF05970         ----evypdllankedkeflaerailapknedvdevNdsllkklegeek---------------------
PF10412         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           GGQTLKEVIFSNGQNVQILNVKPSRKKLVAKNVGEIEVEYIMLECETHDEDEDDYKRAWFSVIADDNTAQ
PF01443         ----------------------------------------------------------------------
PF01443         ----------------------------------------------------------------------
PF02562         ----------------------------------------------------------------------
PF05970         ----------------------------------------------------------------------
PF05970         ----------------------------------------------------------------------
PF05970         ----------------------------------------------------------------------
PF10412         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           AISEFLSIIADKYRSRAVFPAWKDFWAIKNTFTKVRPLGAMTFHKSQGSTFKNAYLFTPCLHSYCRDPDV
PF01443         -----------------------------------r...vttvhevqGltfdkVtlvldketdlllis..
PF01443         -----------------------------------r...vttvhevqGltfdkVtlvldketdlllis..
PF02562         ----------------------------------------------------------------------
PF05970         ---------------------------------------altinKsqGQtLskvgvy-------------
PF05970         ---------------------------------------altinKsqGQtLskvgvy-------------
PF05970         ---------------------------------------altinKsqGQtLskvgvy-------------
PF10412         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           AQELIYVGNTRARENVGFV---------------------------------------------------
PF01443         srenllvAlTRhrkslvi----------------------------------------------------
PF01443         srenllvAlTRhrkslvi----------------------------------------------------
PF02562         ----------------------------------------------------------------------
PF05970         ----------------------------------------------------------------------
PF05970         ----------------------------------------------------------------------
PF05970         ----------------------------------------------------------------------
PF10412         ----------------------------------------------------------------------