[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for bp441:AAQ81348.1


[Show Plain Result]

## Summary of Sequence Search
   1::152
   1::134  PF03013 0.0% 53.2258064516129  Pyrimidine dimer DNA glycosylase 
   1::152


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTRINLEHPSLLCNAHLVGEWYENPRVASILIKKNGRTGKIPKRFTVRTNKNPDGGRGHVTFFYNKLAWL
PF03013         MtrinleliseLpdqhLlaeyrElpri.nalakkergngkipkhftl........gtGHvtfFynkleyL


                         -         -         *         -         -         -         -:140
query           RDRYLMLMDEMTKRGYSPTDNWKVEIFFPEYTHLFGEWTPTEADISLSRTRIAEMIPEKHKLTNEQLEKL
PF03013         rkrhlllieEmlkRgynvneewkddiseve.keyrgdwtpteeaialnleriaekipikpehdk------


                         +         -         -         -         -         *         -:210
query           SAIAEYEAFNEK----------------------------------------------------------
PF03013         ----------------------------------------------------------------------