[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for bp441:AAQ81392.1


[Show Plain Result]

## Summary of Sequence Search
   1::216
 183::214  PF05565 0.0% 34.375  Siphovirus Gp157 
   1::216


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTKHKDLNRFLKNTHDTTGNKYRKSRDLNSRFADKHHFMRLLNNLLPSEMKWSSFGSRFGIAKISPNHIN
PF05565         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           LAAVGTHSVCGTIWVNTSFESDCVTNRLQTLEAYGVFVEVARRTNGSNHVVTFSVDLPNGDKAPVKNVET
PF05565         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           KTEVVSTVDYTEPAKEPDGQNIFFAPETMQAVQLVRGVFHFASVRISEIDEEIKELQARRKEIEDNIKSI
PF05565         ------------------------------------------eadieaikaekkrleerkksienkvkrl


                         -         -         -         +         -         -         -:280
query           KNAIGA----------------------------------------------------------------
PF05565         kdyl------------------------------------------------------------------