[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for bp441:AAQ81419.1


[Show Plain Result]

## Summary of Sequence Search
   1::191
   3::184  PF00265 0.0% 31.2138728323699  Thymidine kinase 
   1::191


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAKLHFHYAAMNSGKSTHLLQVAYNYMERNMKPLILKPAIDTRDGDNVSSRIGISQKAHMISQDDNLKAF
PF00265         --sielilgpmfsGKsteLirrvkryklakkkvvvikaakdnRykeakvvthdgisleak..ksktssle


                         -         -         *         -         -         -         -:140
query           CEKLIELDGIDCILVDEAQFLTVDQVHQLGDVVDYINVPVMCYGLLSDSNGHLFPASAELLVLAERKVEH
PF00265         dikealeke.vdvvgvDEaqFfk.qdivelseklanegkkvivagLdtdFerklFesilkllplaekvtk


                         +         -         -         -         -         *         -:210
query           ETICWCGKKATMTMRMNEHGEKIWGPRVSIGGNDRFISVCRRHWKEGKIQK-------------------
PF00265         LkavCmkCykdAsftkrlnkekeii.....liGgkekYvsvCrk--------------------------