[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for bp441:AAQ81437.1


[Show Plain Result]

## Summary of Sequence Search
   1::122
  24::103  PF01228 0.0% 46.7532467532468  Glycine radical 
   1::122


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLIGFQLLDGSNDHGSIFLVDDQTNNAKVIASKTYEIDTIVEDSVIRGRPGRFFDVQPEPTVEGGQHLNV
PF01228         -----------------------seldgisvnlkatpdalgk.edeerienlatlldg..yfeggqhlnv


                         -         -         *         -         -         -         -:140
query           NVLDRNTLEDAIVNPEKYPQLTIRVSGYAVRFNALTPEQQRDVITRTFTQSL------------------
PF01228         nvlsretLldAqehPekypqLtiRVsGYavrfn-------------------------------------