[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for bp441:AAQ81502.1


[Show Plain Result]

## Summary of Sequence Search
   1::342
   3::336  PF11091 0.0% 55.8912386706949  Tail-tube assembly protein 
   1::342


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKVTELIDGGVQDVVKGILKGENPAGGSTPRQPLSKITIAQFPAERNAANDSTQDFNVNDLYKNGLLLSA
PF11091         --vke.isddvvdlikeikssktsagqstktksetkivtaqfPaeraagndsa..fnvndLykNgLlftA


                         -         -         *         -         -         -         -:140
query           FNYSGRQTGDLRSFRTDQNNIGDYRKGVVKEAIANILMPKGQTDIDTINHKFNDVQQSLVERGNGSITGA
PF11091         ydltsrtsgslrdlRqslsassilskaagevssklakktkatidkeaianillPRsksdvdevsHkyndv


                         +         -         -         -         -         *         -:210
query           LSSMASHAVYGGLESITQGAFADRGEQVYIASRAMYAGAENRTKTYTWQLTPRNVYDLVEIIKIYEMLSY
PF11091         qdsliakgggaatgilsnlastavfgalesitkgiladsgeqidttsrsmYkgaenRtktflyqltprsl


                         -         -         -         +         -         -         -:280
query           YSYGSVEKSNTANDIRKSVDAAYKETIINPLTPEATHGQTTMFERITSFLSNVNVVSNPIIWTIRNFGQS
PF11091         edLkeiikiyelflllsygeteksttakelkgkideaykstlikkatpedasknktlgegitsflsnvev


                         -         *         -         -         -         -         +:350
query           SSFDSRSDIFGPAQIQSIRFDKSPDGHFGGLAVAPNLPSSFVLEVTFREILALNRSDLYSED--------
PF11091         vknPpvWmieefgetssldtrkdvfGPaqitsvrldktpdgifnglaiapnlPsti--------------