[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for bp441:AAQ81503.1


[Show Plain Result]

## Summary of Sequence Search
   1::285
 148::246  PF06841 0.0% 27.2727272727273  T4-like virus tail tube protein gp19 
   1::285


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MYRLDEFQQELNKDFQRSNMFSVVFATTPSSKTTELLDGFGGFLYNNLPFGKDFAGLTQGMISSSLNKII
PF06841         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           VQGTQSVMRSSGVSKYLIGAMTSRTVQSILGQFEVGTYLLDFFNAGNTHTGLTVYSVQMPENRLGYEMDK
PF06841         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           FHNAPNIKLMGREYDPLVISFRMDHQASNYRAMQDWVNAVEDPVTGLRSLPADVEADIQINLHARDGIPH
PF06841         -------klpgrtkydnltLkrgltn....dselekWfeavleggdkea......rkditielldeegtp


                         -         -         -         +         -         -         -:280
query           TVTMFGGCIPVAVSSPELSYEDNNTITTFNVTFAYRVMSVGAVNMAMVDDWLKGDLLPALGSQAGGWLSK
PF06841         vvrwklenawPvklsgpelda.ssnevaietleLay----------------------------------


                         -         *         -         -         -         -         +:350
query           FGPFS-----------------------------------------------------------------
PF06841         ----------------------------------------------------------------------