[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for bp441:AAQ81516.1


[Show Plain Result]

## Summary of Sequence Search
   1::172
   3::131  PF00383 0.0% 56.8421052631579  Cytidine and deoxycytidylate deaminase zinc-binding 
   1::172


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKVSSVLQHAYIVAQESHCVSWKVGAIITKDGRIISTGYNGTPAGGHENCDDHAKAAGWLDPETGKLKAM
PF00383         --deklleialeaakeaykcsnfkvGavivkkngeiistgyngepaggs.....................


                         -         -         *         -         -         -         -:140
query           YRQAHNEWSSCNEIHAELNAILYAAKSGQSIDGAEMYVTVSPCRECAKAIAQSGIKKVFYNELYDRNTPG
PF00383         .............ktiHAEvnAilsaaknggsklegatlyvtlePCgmCakaiiesgikkv---------


                         +         -         -         -         -         *         -:210
query           WDEILVKSGIKVIHNKVPLNLLKKEFTVSNQN--------------------------------------
PF00383         ----------------------------------------------------------------------