[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for bp441:AAQ81560.1


[Show Plain Result]

## Summary of Sequence Search
   1::145
   6::140  PF06591 0.0% 27.2727272727273  T4-like phage nuclear disruption protein (Ndd) 
   1::145


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSKQNLNVQRIISAGAQRLGHFENGNFKFVTGKSKDDARGKGFYFIVSAGVVKARTFVGDQETNRGFNET
PF06591         -----ltvkdllavgaevvavvkngey.flgseskeilskegfyflvskldgrqfsnpcvaarfyvgrqr


                         -         -         *         -         -         -         -:140
query           IYRVCHGFQPLTDEIWSKSYSLNQVVYFMPLHLVPSLLKSPAQLELFGENMAKAQTLTTVSRQLFKVYNF
PF06591         skqgldavlshirqrrsqlartiatnn..veydviylsakkmkplttgygkgqlalaftrnhsseyqtle


                         +         -         -         -         -         *         -:210
query           EYQKR-----------------------------------------------------------------
PF06591         ----------------------------------------------------------------------