[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for bp441:AAQ81341.1


[Show Plain Result]

## Summary of Sequence Search
   1::439
 125::439  2.4e-29 28.6% 0050357 00503571 1/1   p containing nucleoside triphosphate hy 
   4::441  6.8e-26 21.4% 0048956 00489561 1/1   p containing nucleoside triphosphate hy 
   4::178  9.5e-21 23.2% 0050356 00503561 1/1   p containing nucleoside triphosphate hy 
  10::147    2e-10 27.4% 0043794 00437941 1/1   p containing nucleoside triphosphate hy 
  10::146  2.9e-10 26.5% 0043792 00437921 1/1   p containing nucleoside triphosphate hy 
  26::142  2.9e-10 22.1% 0051289 00512891 1/1   p containing nucleoside triphosphate hy 
   6::201  6.4e-10 21.7% 0049837 00498371 1/1   p containing nucleoside triphosphate hy 
   2::180  9.5e-10 28.3% 0047420 00474201 1/1   p containing nucleoside triphosphate hy 
   6::141    1e-08 21.8% 0043798 00437981 1/1   p containing nucleoside triphosphate hy 
  10::176    1e-08 24.7% 0037996 00379961 1/1   p containing nucleoside triphosphate hy 
   2::180  1.4e-08 27.8% 0049491 00494911 1/1   p containing nucleoside triphosphate hy 
   2::180  1.9e-08 23.6% 0047665 00476651 1/1   p containing nucleoside triphosphate hy 
  10::175  3.1e-08 27.4% 0043012 00430121 1/1   p containing nucleoside triphosphate hy 
  10::180  4.7e-08 24.5% 0039472 00394721 1/1   p containing nucleoside triphosphate hy 
  25::366  6.3e-08 18.1% 0047756 00477561 1/1   p containing nucleoside triphosphate hy 
   2::143  1.4e-07 27.4% 0036729 00367291 1/1   p containing nucleoside triphosphate hy 
   6::220  1.9e-07 20.9% 0050350 00503501 1/1   p containing nucleoside triphosphate hy 
   3::180  3.9e-07 27.0% 0049053 00490531 1/1   p containing nucleoside triphosphate hy 
  10::175  7.2e-07 26.4% 0040238 00402381 1/1   p containing nucleoside triphosphate hy 
  24::141  9.2e-07 27.0% 0046258 00462581 1/1   p containing nucleoside triphosphate hy 
  19::94   1.6e-06 28.2% 0046442 00464421 1/1   p containing nucleoside triphosphate hy 
  23::98   1.8e-06 27.0% 0047538 00475381 1/1   p containing nucleoside triphosphate hy 
  10::142  2.2e-06 30.7% 0047394 00473941 1/1   p containing nucleoside triphosphate hy 
  22::255  2.4e-06 20.4% 0048939 00489391 1/1   p containing nucleoside triphosphate hy 
   4::143  2.5e-06 24.8% 0040419 00404191 1/1   p containing nucleoside triphosphate hy 
   9::168  3.1e-06 25.2% 0036850 00368501 1/1   p containing nucleoside triphosphate hy 
   7::158  5.5e-06 21.3% 0043258 00432581 1/1   p containing nucleoside triphosphate hy 
   4::133  5.6e-06 20.8% 0038151 00381511 1/1   p containing nucleoside triphosphate hy 
  22::259  7.6e-06 20.5% 0049933 00499331 1/1   p containing nucleoside triphosphate hy 
  19::206  8.1e-06 19.0% 0047839 00478391 1/1   p containing nucleoside triphosphate hy 
  10::175  9.4e-06 29.3% 0043790 00437901 1/1   p containing nucleoside triphosphate hy 
   9::130  9.8e-06 24.8% 0046276 00462761 1/1   p containing nucleoside triphosphate hy 
  12::143  1.2e-05 24.8% 0038674 00386741 1/1   p containing nucleoside triphosphate hy 
  25::139  1.4e-05 22.2% 0045970 00459701 1/1   p containing nucleoside triphosphate hy 
   6::171  1.6e-05 24.1% 0052796 00527961 1/1   p containing nucleoside triphosphate hy 
  19::149  1.7e-05 17.5% 0051138 00511381 1/1   p containing nucleoside triphosphate hy 
  10::175  2.2e-05 26.9% 0040237 00402371 1/1   p containing nucleoside triphosphate hy 
  25::49   2.2e-05 44.0% 0047772 00477721 1/1   p containing nucleoside triphosphate hy 
   4::141  2.3e-05 26.9% 0045717 00457171 1/1   p containing nucleoside triphosphate hy 
   7::185  2.4e-05 21.0% 0041617 00416171 1/1   p containing nucleoside triphosphate hy 
  25::122  2.7e-05 21.1% 0047813 00478131 1/1   p containing nucleoside triphosphate hy 
   4::141  2.8e-05 21.5% 0050374 00503741 1/1   p containing nucleoside triphosphate hy 
  21::135  2.9e-05 24.3% 0042008 00420081 1/1   p containing nucleoside triphosphate hy 
  25::63   3.1e-05 33.3% 0047808 00478081 1/1   p containing nucleoside triphosphate hy 
  10::180  3.2e-05 24.1% 0037926 00379261 1/1   p containing nucleoside triphosphate hy 
   1::64   3.3e-05 32.8% 0043440 00434401 1/1   p containing nucleoside triphosphate hy 
  13::124  3.5e-05 26.2% 0046895 00468951 1/1   p containing nucleoside triphosphate hy 
   2::133  3.6e-05 19.8% 0038141 00381411 1/1   p containing nucleoside triphosphate hy 
   9::140  4.5e-05 29.2% 0048266 00482661 1/1   p containing nucleoside triphosphate hy 
   1::68   4.6e-05 33.8% 0035848 00358481 1/1   p containing nucleoside triphosphate hy 
  22::143    5e-05 25.9% 0043986 00439861 1/1   p containing nucleoside triphosphate hy 
  26::216  6.4e-05 16.2% 0049190 00491901 1/1   p containing nucleoside triphosphate hy 
  24::49   6.6e-05 46.2% 0046162 00461621 1/1   p containing nucleoside triphosphate hy 
  19::49   6.7e-05 45.2% 0053315 00533151 1/1   p containing nucleoside triphosphate hy 
  19::139  7.6e-05 20.2% 0048963 00489631 1/1   p containing nucleoside triphosphate hy 
  16::61   7.8e-05 25.6% 0048025 00480251 1/1   p containing nucleoside triphosphate hy 
  10::48   8.2e-05 34.2% 0047844 00478441 1/1   arboxykinase-like                       
  18::139  8.4e-05 26.2% 0034832 00348321 1/1   p containing nucleoside triphosphate hy 
  10::59   8.7e-05 33.3% 0047841 00478411 1/1   arboxykinase-like                       
  10::117  8.7e-05 24.5% 0049611 00496111 1/1   p containing nucleoside triphosphate hy 
  26::49   8.8e-05 45.8% 0050194 00501941 1/1   p containing nucleoside triphosphate hy 
  13::125  9.5e-05 25.9% 0049853 00498531 1/1   p containing nucleoside triphosphate hy 
  22::95   9.5e-05 27.0% 0050867 00508671 1/1   p containing nucleoside triphosphate hy 
  23::49   9.5e-05 48.0% 0047933 00479331 1/1   p containing nucleoside triphosphate hy 
   2::140   0.0001 19.4% 0050676 00506761 1/1   p containing nucleoside triphosphate hy 
   6::66   0.00011 28.1% 0036317 00363171 1/1   p containing nucleoside triphosphate hy 
  19::48   0.00011 51.9% 0048706 00487061 1/1   p containing nucleoside triphosphate hy 
  15::66   0.00014 26.9% 0044893 00448931 1/1   p containing nucleoside triphosphate hy 
  21::210  0.00015 15.9% 0047291 00472911 1/1   p containing nucleoside triphosphate hy 
  26::49   0.00015 54.2% 0046459 00464591 1/1   p containing nucleoside triphosphate hy 
   6::139  0.00017 20.3% 0051499 00514991 1/1   p containing nucleoside triphosphate hy 
  10::142  0.00019 28.8% 0042094 00420941 1/1   p containing nucleoside triphosphate hy 
  25::95   0.00019 28.1% 0049657 00496571 1/1   p containing nucleoside triphosphate hy 
  26::49    0.0002 54.2% 0048692 00486921 1/1   p containing nucleoside triphosphate hy 
  19::212  0.00021 18.3% 0052004 00520041 1/1   p containing nucleoside triphosphate hy 
  25::49   0.00022 44.0% 0051604 00516041 1/1   p containing nucleoside triphosphate hy 
  25::49   0.00023 52.0% 0051206 00512061 1/1   p containing nucleoside triphosphate hy 
  26::49   0.00024 50.0% 0051535 00515351 1/1   p containing nucleoside triphosphate hy 
  14::66   0.00025 30.2% 0047537 00475371 1/1   p containing nucleoside triphosphate hy 
  25::49   0.00028 44.0% 0053350 00533501 1/1   p containing nucleoside triphosphate hy 
  10::49    0.0003 40.0% 0044438 00444381 1/1   p containing nucleoside triphosphate hy 
  26::49    0.0003 54.2% 0049606 00496061 1/1   p containing nucleoside triphosphate hy 
  10::142  0.00033 25.4% 0052726 00527261 1/1   p containing nucleoside triphosphate hy 
  25::49   0.00033 44.0% 0049398 00493981 1/1   p containing nucleoside triphosphate hy 
  24::49   0.00034 42.3% 0047073 00470731 1/1   p containing nucleoside triphosphate hy 
  25::49   0.00039 48.0% 0049919 00499191 1/1   p containing nucleoside triphosphate hy 
  26::49   0.00039 45.8% 0051851 00518511 1/1   p containing nucleoside triphosphate hy 
  26::49   0.00039 45.8% 0053247 00532471 1/1   p containing nucleoside triphosphate hy 
  25::49   0.00046 52.0% 0045785 00457851 1/1   p containing nucleoside triphosphate hy 
  26::59   0.00046 46.4% 0048702 00487021 1/1   p containing nucleoside triphosphate hy 
  22::95   0.00047 29.0% 0049825 00498251 1/1   p containing nucleoside triphosphate hy 
  26::65   0.00049 35.0% 0048410 00484101 1/1   p containing nucleoside triphosphate hy 
  25::49   0.00052 54.2% 0048689 00486891 1/1   p containing nucleoside triphosphate hy 
  10::98   0.00054 24.4% 0040410 00404101 1/1   p containing nucleoside triphosphate hy 
  10::98   0.00054 24.7% 0050044 00500441 1/1   p containing nucleoside triphosphate hy 
  26::49   0.00055 54.2% 0051580 00515801 1/1   p containing nucleoside triphosphate hy 
  19::49    0.0007 46.2% 0048050 00480501 1/1   p containing nucleoside triphosphate hy 
  10::180  0.00072 26.0% 0041830 00418301 1/1   p containing nucleoside triphosphate hy 
  25::49   0.00073 52.0% 0045788 00457881 1/1   p containing nucleoside triphosphate hy 
  23::108  0.00074 24.7% 0046441 00464411 1/1   p containing nucleoside triphosphate hy 
   1::95   0.00075 31.8% 0037960 00379601 1/1   p containing nucleoside triphosphate hy 
  19::127  0.00079 20.2% 0038720 00387201 1/1   p containing nucleoside triphosphate hy 
   1::98    0.0008 24.0% 0042070 00420701 1/1   p containing nucleoside triphosphate hy 
  26::49   0.00088 54.2% 0046916 00469161 1/1   p containing nucleoside triphosphate hy 
  25::49    0.0009 45.8% 0047607 00476071 1/1   p containing nucleoside triphosphate hy 
   7::142  0.00098 21.7% 0038162 00381621 1/1   p containing nucleoside triphosphate hy 
   1::439


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLTYDDLTNGQKLAIDGAMDAISTKRHITIRGPAGTGKTTLTKFLLDRLFQTGQQGIVLAAPTHQAKKEL
00503571   1/1  ----------------------------------------------------------------------
00489561   1/1  ---llaliedilatlnpeQreavraa......ggplliqGgpGTGKTttlveriayllleggvppkrilv
00503561   1/1  ---kPydrLldivgigfltaddialalgiagdsperlllalallsellgeghlylplddlveellkllel
00437941   1/1  ---------gqeevlkalslalekgrpehlllvGppGtGKTtlakalaglllptsggvrvlgidaselld
00437921   1/1  ---------gqeealerlllalkagklphlllvGppGvGKTtlaralarlllgsgggvdvieldasdlrg
00512891   1/1  -------------------------evilltGppGvGKTTlakalagelgakfgsvsltgrdvrsarrgi
00498371   1/1  -----kLnpeQreairaa......ggpllvqGppGTGKTttlvariaylllegglppkrilvvtftnaaa
00474201   1/1  -deelelleklslllveklrpvllddlv.gqeeakeallealragrpghvllvGppGtGKTtlaralane
00437981   1/1  -----lveklrpknldkvigqeealkdlslalkpgeiphalllvGppGsGKttlaralagllgpdsgkil
00379961   1/1  ---------GqeealralslalaagppegvllvGppGtGKstlaralagllppdsgrivlvgnlsdlldp
00494911   1/1  -llveklrpvllddlv.gqeeakeallealaagrpghvllvGppGtGKTtlaralanellrlgvlglpfv
00476651   1/1  -yeplveklrpvllddlv.gqeeakeallealaggrpprpvllvGppGtGKTtlaralanelgrpfvpva
00430121   1/1  ---------gqeeakeallealrrgrkglelgirpggnvllvGPpGvGKTtlakalagllfpsgvpfiri
00394721   1/1  ---------greealeallealrrgpprnvlLvGppGvGKTtlakalakelaagsgpilldgvpvvrldl
00477561   1/1  ------------------------kkpkvillvGppGsGKtTlaraLakrlaelgkgvvvidtddlrr..
00367291   1/1  -vtlddvv.gqeeakeallealelalkgldlflslglrpgrnvllyGppGtGKTtlaralanel...gap
00503501   1/1  -----ptlnpeQreairapl.....kgpllvqGgaGtGKTttlvhriarlllngvpeslkekrvpperiL
00490531   1/1  --tlpaleseardltekarpvllddvi.GqeeaierllealergppgnvLlvGppGtGKTtlaralakel
00402381   1/1  ---------gqdeaieallealrrarkglnlglkprgnvlLvGppGtGKTtlaralakal...gvpfvri
00462581   1/1  -----------------------edleslllnplvkfedivpkvlddleealealaeaklpppkgvllyG
00464421   1/1  ------------------M...kkgkfIvieGpdGsGKTTlaklLae.l.elgigvvvtrEPvdywrevg
00475381   1/1  ----------------------mkgeiialtGpsGsGKsTlarlLagllk..ptsgivsvdglrlavlsr
00473941   1/1  ---------gqeevkkalllalalallrgepgehvlLvGppGtGKTtlaralagll...gapfielsasd
00489391   1/1  ---------------------lsikkgklivltGppGsGKtTlakaLaerl......glpv.istddllr
00404191   1/1  ---leelkealkealellslgikpgeivllyGppGtGKTtlakalanelkkr..ggrvlyvsadelvskl
00368501   1/1  --------kerllllelrnvllddviGqeeakealsealelplkrpelfdglgvelpgknvlLvGppGvG
00432581   1/1  ------lrpyQkeaiealle....gknvllvapTGsGKTlvallailellerng.kkvlvlvPtraLaeq
00381511   1/1  ---ffeltpiQkeaipailk....grdlllvapTGsGKTlaallpalelllkgk.rvlvlaPtrelaeqi
00499331   1/1  ---------------------PslslkkgklivltGppGsGKtTlakaLaerl...glpfidtddllrep
00478391   1/1  ------------------ms.ikkgklilltGppGsGKtTlaralaerl...glpvidgddllrelvgeg
00437901   1/1  ---------gqeeakeallealalararplkrpelflslgirpgrillLyGppGvGKTtlakalakel..
00462761   1/1  --------yygdvtaldgvsltikkgevialvGpsGsGKsTlaraLagllpeepgsgvvlldgddlr...
00386741   1/1  -----------lealkavllgirpgehllLvGppGtGKTtlaralagel...ga................
00459701   1/1  ------------------------MpkvillvGppGsGKTTlakaLakrlgekgvkvvvidtddlrreai
00527961   1/1  -----Likkllkdllilllklgellleallellleellllallllellelleklllflllllpelleell
00511381   1/1  ------------------llllkpgglvlitGPtgsGKsttLlraln..rleeagkgvilvkdaidtrlg
00402371   1/1  ---------GqeealeallealrrrpgrnvllvGppGvGKTtlaralagllvrssgpilldgvpfvrlda
00477721   1/1  ------------------------kpklilltGppGsGKttlaraLaee---------------------
00457171   1/1  ---lddiv.gleeakellleallagrlphalLlyGppGtGKttlakalakellglnflsvslselcskcv
00416171   1/1  ------diigqeeakkallealslaartgenvllvGppGtGKttlaralakllpr...........sgvp
00478131   1/1  ------------------------kgkvivltGppGsGKtTlarlLaellkplglgvvvidgddlrreav
00503741   1/1  ---fifldlrplallplpdrlvgrdeeiealskalggaldgvslsiepggivllvGppGvGKTtLaklla
00420081   1/1  --------------------smkkglrIaleGpsGvGKTTlaklLarhlgptggrvllvgEPiaywrsvg
00478081   1/1  ------------------------gkvivltGppGsGKtTlarlLaellkplgggvvvidtdd-------
00379261   1/1  ---------GqeeakealsealrlplkrlelferlglrrpgknvlLvGppGvGKTtlaralAkll...ga
00434401   1/1  Mls...ksyggllalddvslsvkkgliigitGpsGsGKTTlaraLaellrerggsvavidlddf------
00468951   1/1  ------------lnvlgesidalgkilseilkllekgfltalgllerksverlstgikaLDlllgiGglp
00381411   1/1  -lgfe.ltpiQkeaipailk....gedvllvapTGsGKTlaallpaleallkgk.rvlvlaptrelaeqi
00482661   1/1  --------kkvaivllsnyalsislddlllildlykevqvaydnfykvdesdiayqyallakedenaaaf
00358481   1/1  algpfeltpiQqeaipaileglesgprdvllvgptGtGKTltaaalalel...gkqvlvlaptrelae--
00439861   1/1  ---------------------kleeveristgipeldellgGglpkgslilitGppGsGKTtlalqlaan
00491901   1/1  -------------------------lmkgkiilltGppGsGKttlakaLaeel......glpfidtddll
00461621   1/1  -----------------------mkgmiialtGppGsGKsTlaklLaer---------------------
00533151   1/1  ------------------MsldikkgklivltGppGsGKtTlarlLaer---------------------
00489631   1/1  ------------------M....kgklillvGppGsGKtTlaraLaell...glpfiridgddllrellg
00480251   1/1  ---------------EdlslavgkgkvialvGkgGvGKTTtaakLaaalaergkkvllidl---------
00478441   1/1  ---------aevlalhgvsldin.gegvlivGpsGsGKStlalaLagl----------------------
00348321   1/1  -----------------ilealrsgrvvllvgptGsGKTtlalalalel...ggrvlvlvptralaeqla
00478411   1/1  ---------Ggvlalhgvsldve.gevvlltGpsGsGKStllralagl.......Gtil-----------
00496111   1/1  ---------elenltklytgikaLddllslgippGeivllvGpsGsGKTtlalrllagllkptggkvlii
00501941   1/1  -------------------------klilltGppGsGKttlaralaeel---------------------
00498531   1/1  ------------ldklgkildlalkileksflklevlalgvlerkeverlstGikaLDallgiGglprGs
00508671   1/1  ---------------------hvsllklgeldislsikkgevivlvGpsGsGKsTlaraLakrLeepgsg
00479331   1/1  ----------------------a.pkli.ltGppGsGKttlakaLaeel---------------------
00506761   1/1  -lllelgflelrpyQleaipalle....g.dvllaaptGsGKTlaallpilelllrggkrvlvlvPtrel
00363171   1/1  -----eprpyQqeaiealleglekgkknvllvgptGtGKTltaaalaael...gkpvliv.aptke----
00487061   1/1  ------------------ldM...kkgklIvieGppGsGKtTlakaLa----------------------
00448931   1/1  --------------LddvslsvepgevialvGpnGsGKTTllnalagllapdggkvllvgadiarl----
00472911   1/1  --------------------mkmkkgklilltGppGsGKtTlaraLaell......gapfisgddllrgl
00464591   1/1  -------------------------klivltGppGsGKtTlakaLaerl---------------------
00514991   1/1  -----lellidlglpfelrpyQleaveallellekgrgglladptGsGKTlvalllilellergpakrvl
00420941   1/1  ---------gqeeakeallealalplkrldlglslgirpgkgvllyGppGtGKTtlakalagel...gap
00496571   1/1  ------------------------GkgelivllGpsGsGKsTlarlLagll......ggsv.ldtgepir
00486921   1/1  -------------------------mlivltGppGsGKtTlakaLaerl---------------------
00520041   1/1  ------------------iipallsgrdvvllaaptGsGKTlaallpilelllegggrvlvlaPtralae
00516041   1/1  ------------------------mlkgklillvGppGsGKtTlarala---------------------
00512061   1/1  ------------------------kkkkgklivltGppGsGKtTlakaL---------------------
00515351   1/1  -------------------------mngklivltGppGsGKtTlaraLa---------------------
00475371   1/1  -------------alddvslsikkgevialvGkgGvGKTTlaanlagllaptggkvlligaDirrp----
00533501   1/1  ------------------------rgeiialtGpsGsGKsTlaklLael---------------------
00444381   1/1  ---------gqeeakkalslalelplkrlelfgklddligrspairrll---------------------
00496061   1/1  -------------------------gklivltGppGsGKtTlaklLaer---------------------
00527261   1/1  ---------npfilgpkvdledfigreeelkeleeal..pkivlltGprGsGKTtllkalakel...gkp
00493981   1/1  ------------------------kpklilltGppGsGKttlaraLaee---------------------
00470731   1/1  -----------------------arpltfddvvgqdeakeeleellagl---------------------
00499191   1/1  ------------------------kgkiigitGpsGsGKsTlaklLael---------------------
00518511   1/1  -------------------------klIvleGpsGsGKsTlaklLaekl---------------------
00532471   1/1  -------------------------pGkiIvitGpsGsGKsTlarlLae---------------------
00457851   1/1  ------------------------PkgklivltGppGsGKtTlakaLae---------------------
00487021   1/1  -------------------------rmkiivltGpsGsGKsTlarlLaell......gv-----------
00498251   1/1  ---------------------vekllglalllieklflkvlprllsllelenlskiytgipaldvslglg
00484101   1/1  -------------------------kgpvigivGpsGsGKTTllraLagllkprggrvavigldi-----
00486891   1/1  ------------------------m.livltGppGsGKtTlakaLaerl---------------------
00404101   1/1  ---------elenlsksyggvlalkdvsltvepgeivalvGpnGaGKSTllkllagll...ptsGeilld
00500441   1/1  ---------lllelllelknlsksyggvlalddvsltikpgeivalvGpnGaGKSTllkllagllkptsG
00515801   1/1  -------------------------llIvltGppGsGKtTlaklLaerl---------------------
00480501   1/1  ------------------M.....gklillvGppGsGKtTlaralaell---------------------
00418301   1/1  ---------GqeeakkallealalplkrlelfeklrgirpgknvlLvGppGtGKTtlaralakll...gr
00457881   1/1  ------------------------mgklivltGppGsGKtTlaklLaer---------------------
00464411   1/1  ----------------------vkkgeiivllGpsGsGKsTlaklLagllgptggsvlltgepvsgeplg
00379601   1/1  llelenlsfsygg.kealkdlslaiepgelvlivGptGsGKTTllkallgllppd..egiitiegpdel.
00387201   1/1  ------------------mssgepllevenlskryggklalkdvslsvekgeivlLlGpnGaGKTtLlra
00420701   1/1  lpllelenlsksypgggvlalkdvsltvepgeivalvGpnGsGKSTllkllagllk..ptsGeilldgld
00469161   1/1  -------------------------llIvieGppGsGKsTlaklLaerl---------------------
00476071   1/1  ------------------------kgkiigltGpsGsGKsTlaklLae.---------------------
00381621   1/1  ------ltpiQkeaipelleglesgkpknvllagptGsGKTlvallailelllrg.kqvlvlvPtralae


                         -         -         *         -         -         -         -:140
query           SKHALRKAYTIQSLLKINPSTLEENQIFEQKGTPDFSKIRVLICDEVSFYTRKLFNILMKTVPSHCVIIG
00503571   1/1  ------------------------------------------------------yrllkalfg.garlil
00489561   1/1  vtftnkAadelrerllklllenldglevsTfhslalrilrrfalllgldpnftilddadqllllkeilre
00503561   1/1  delllelieleellkelleeilvellkedlelvlderrlyleeleldelglaellkelleeleideklld
00437941   1/1  pselsggerqrvliarall.....................adpkvlllDEidaldpeaqnaLlklleelp
00437921   1/1  vddlreli....................gevlqalglllggkpdvlllDEidrldpdaqnallklleelp
00512891   1/1  gyvfq....tveellgllaelvglevrgeleellktlikelsggekqrvalarallakpdvlllDEidgl
00498371   1/1  delrerllkllgelgldgvevstfhslalrllrryalelglppdflildeadmldllkellkalldelrl
00474201   1/1  lprslpglpfvrvnasdltdvglle.ellgkllgaat....................fllakpgvlflDE
00437981   1/1  ldgkdi..........rrgiglvfqliglfphltvlelvalgl.ggilveevrellkellsgGqkqrvai
00379961   1/1  kdlrellragiplvflnfaalpasllesel.........lsggerqrvalaralalrpGllvlAdggvll
00494911   1/1  rvnasellealllsdlfgellgallralfellrgalela............kggvlflDEidrlspdvqn
00476651   1/1  llcfvrvncaallelsasdll..eselfgeekeaflgallerlgklalagggtvlflDEidkldpdvqna
00430121   1/1  nlseltekllvselighppgyvGedelgvlfeaark..............................apps
00394721   1/1  sellsvsdlvgel...............egglrgllteala...lakpsvlflDEidrlldardsessle
00477561   1/1  .....alifqdeldlfdedreegfrvpeelvrellkellarllaeggdvvilDgt.nltleqrealrrll
00367291   1/1  firvdaselleklvgegegrlrgalaealr.....................adpgvlflDEidalagkrg
00503501   1/1  vvtfTnkAadelrerlrkllgellrlgdndlfldlitlvlpglgeglvdarnllkpalarldllaitTih
00490531   1/1  argdvpevlvgvpvieinassllfGskyvgefeealrrl..fgeaekanggv..................
00402381   1/1  nlselteallvsdliGhl..dgyvgededgiltgalrkap............ggvlflDEidkldpdvln
00462581   1/1  ppGtGKTtlaralakel...glpfvrinasdllvgllvgelegrlrglfteav.................
00464421   1/1  gtpllelirelllaldfgeilldd----------------------------------------------
00475381   1/1  dllgllreglirigyvfqdyalfprltv------------------------------------------
00473941   1/1  llgesdlrggfkqa.............................akpgvlflDEidrldrevqnaLlelle
00489391   1/1  eavpggtdlgelfqdlllegellfideiaelllealaeaegkvvildgtg.ldieqrealrelllelprp
00404191   1/1  sgglqeqrvaiafalar.....................kpdllllDEidalgldpelqeellelldelae
00368501   1/1  KTtlaralakll...gapfiridgseltekdyvGesvearlrelfeeaigyvfqdp.alfpgtvlenlal
00432581   1/1  iaeelkklfgilglkvavltg.glskkerlrgdadivvaTperldsllrrl.....lddlglviiDEaHr
00381511   1/1  aeelrkllgflgldlelkvallhgglslkereealedlgeadilvaTpgrlldllrdlknldl-------
00499331   1/1  vig...agtdigevfqdlllaggllvddevrrlllealdelllaggkvvildgfpggllqrealrrll.p
00478391   1/1  grlgrd...lfdedrllfrellideidl......llakgkvvildgtnlsealdealrrllr...pdlvi
00437901   1/1  .gapvieidaselrdvddlsg...............yvgelsggeklrellaealteavlkgkpsvlllD
00462761   1/1  ....lglliglvfqdpdllpfltvlenvllpllaagliv.....ivdgt.lllvglreal----------
00386741   1/1  ............pfvrldaselsggeklrgllaralakpgvlllDEidaldpdvqeallelleegeltiv
00459701   1/1  kqliglglfdedgegalrrreavakllldallkalkagggd......vvilDgt.altleqreallell-
00527961   1/1  kllgfelrpyQleaiealleg....rdvllagptGsGKTlvalllilel....gkrvlvlaPtraLaeqw
00511381   1/1  ielvvsriglvleavglffaldllelll.........qdpdviliDEaqfldpevvevlleladtgilvl
00402371   1/1  selle..................fgkyvgafegglrqllglaraa...kpgvlflDEidsllgarggsgv
00477721   1/1  ----------------------------------------------------------------------
00457171   1/1  geseglhpd...lfllapenspsiifideidallekrsltpleggrkvviideadrlteeaanaLlktle
00416171   1/1  fvrvncsaltedlleselfghekgafgggekq.rlgllrladggvlflDEidkldpdvqnaLlrvleege
00478131   1/1  gqlglglsieeldeal.llpdalrralleealealkag..dvvildgfgrsl------------------
00503741   1/1  gllkpkfgeillfgkvvyvnvselldlkellrllleal.glp..ppyqlsggerlrvalaeallalgkpd
00420081   1/1  gsdlleliyqlplrldlgeislddaallllslqllfaapylslnevidaarvlladefikplpag-----
00478081   1/1  ----------------------------------------------------------------------
00379261   1/1  pfvevdaselteggyvgedlekrirelfqearllvfltvlenirl...daseylekrvvsrligappgyv
00434401   1/1  ----------------------------------------------------------------------
00468951   1/1  rGelvlivGppGsGKTtlalqlaanla..klggkvlyidteesldqlr..arrl----------------
00381411   1/1  aeelrkllgelggdlklkvallhgglslkereealerfgeadilvaTpgrlldgldrlknldl-------
00482661   1/1  lksnrqkklvrdladrviaeerlellekiieellrirldklledldeiveelppvlfddlvgqeeakeal
00358481   1/1  ----------------------------------------------------------------------
00439861   1/1  laknggkvlyisle..esreqlleraerlgldleellllgllsiliadplglsgeellrvllalalel.k
00491901   1/1  reaklggelaeliedlfvprellidlikellka...................gvvildgtnlgleqlral
00461621   1/1  ----------------------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00489631   1/1  ellgrgigfgfqqgdlledatvlenlalllldeidkaledggvvlldgfdrsqlqrlailrallddppd-
00480251   1/1  ----------------------------------------------------------------------
00478441   1/1  ----------------------------------------------------------------------
00348321   1/1  erlakllglrvgllvgylirfes............trilvvtyglllrlldlllsdfdliiiDEahels-
00478411   1/1  ----------------------------------------------------------------------
00496111   1/1  gle..lsaeelrerrrrigyvfqepalfpeltvlenlalglldrlpg-----------------------
00501941   1/1  ----------------------------------------------------------------------
00498531   1/1  ltliaGppGsGKTtlalqlaanla..klggkvlyisteesleql..rarrlgldl---------------
00508671   1/1  vvlldgddlraglsiglilsdedra---------------------------------------------
00479331   1/1  ----------------------------------------------------------------------
00506761   1/1  aeqwaeelrkllgllglkvglltgglslkerlealggadilvttpgrlldlllrdllllsnldlvilDEa
00363171   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00448931   1/1  ----------------------------------------------------------------------
00472911   1/1  ageggkplgllfedaleagfrqrladlirallakg.....kvvild.gtglsreareellellkelgpvl
00464591   1/1  ----------------------------------------------------------------------
00514991   1/1  vvvPrslaeqwaeelkkflpglkvgvltgglkllllgkadivittyelllrllelknl......kfdlv-
00420941   1/1  firidg....................sellgkyvgelsggl......rqllalaraakpsilllDEidkl
00496571   1/1  geplgelirglvfqdpllldeltvl---------------------------------------------
00486921   1/1  ----------------------------------------------------------------------
00520041   1/1  qvaeelr..gltggervrllerllsgeadilvgtpgrl..ldlllrd..lllrnldlviiDEahrldlgf
00516041   1/1  ----------------------------------------------------------------------
00512061   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00475371   1/1  ----------------------------------------------------------------------
00533501   1/1  ----------------------------------------------------------------------
00444381   1/1  ----------------------------------------------------------------------
00496061   1/1  ----------------------------------------------------------------------
00527261   1/1  viyidlselsskgyvdleellrelaeelgellellkkllkklsellglsilglelilglsggdleellee
00493981   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00518511   1/1  ----------------------------------------------------------------------
00532471   1/1  ----------------------------------------------------------------------
00457851   1/1  ----------------------------------------------------------------------
00487021   1/1  ----------------------------------------------------------------------
00498251   1/1  GlppGeivlllGpsGsGKTtLalrl---------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00486891   1/1  ----------------------------------------------------------------------
00404101   1/1  gldltalslaelrrgigyvfqdpalfpg------------------------------------------
00500441   1/1  eilldgkdildlsl....lrrgigyvfq------------------------------------------
00515801   1/1  ----------------------------------------------------------------------
00480501   1/1  ----------------------------------------------------------------------
00418301   1/1  ............................pfirvdaselteaelvGyesgarlrelfaragigllaladpg
00457881   1/1  ----------------------------------------------------------------------
00464411   1/1  e.....ligevfqdgilfpdltvlenvalgrygllgli--------------------------------
00379601   1/1  .....lrnkigyvfQdpvlfp.ltv---------------------------------------------
00387201   1/1  lagllgptsfvvsptftlvreyelGeilldgrdlyrlsleeallllfldeileidgl-------------
00420701   1/1  llllslaellalrrgigyvfqdpalfpg------------------------------------------
00469161   1/1  ----------------------------------------------------------------------
00476071   1/1  ----------------------------------------------------------------------
00381621   1/1  qlaeef..kklfgllglrvgllhgglskkereeileklrsgeadilvgTpellfdllr...lknlglvii


                         +         -         -         -         -         *         -:210
query           IGDKAQIRGVSEDNETHELSPFFTDDRFSQVELDEVKRHQGPIIEVATDIRNGKWIYEKLDEHGNGVKQY
00503571   1/1  vGDpdQliyvfrgavlalllefledflnlrakvveLtenyRqtdesilelanalragn............
00489561   1/1  llldlklflleelleliselknlllspedllelaallellaelyeayeellrerglldfddlllltlell
00503561   1/1  kilddlegilplnpeQkeaieail....kgrvvliqGp--------------------------------
00437941   1/1  kgvtvil---------------------------------------------------------------
00437921   1/1  agvtli----------------------------------------------------------------
00512891   1/1  dp--------------------------------------------------------------------
00498371   1/1  ilvgllaqlssvkaglvlpdlllsllrdllelllaelyeeyeerlrerglldfddlilltl---------
00474201   1/1  idkldpdvqnaLlrlleelpsnvrviattnrpl.......------------------------------
00437981   1/1  a---------------------------------------------------------------------
00379961   1/1  lDEpdaldpevqaaLlrlleegevtieragitlllp----------------------------------
00494911   1/1  aLlrlleelpsnvrviattnrpel...........ldpal------------------------------
00476651   1/1  Llrlleeppsnvrvilttn...........rpekldpall------------------------------
00430121   1/1  vlllDEidkldpdvlnaLlqlleegevtdlggrvv-----------------------------------
00394721   1/1  vlnaLlrlledgnvlviattnrp......ellgrleldpa------------------------------
00477561   1/1  kel...................................................................
00367291   1/1  sgt-------------------------------------------------------------------
00503501   1/1  sfclrilrdfalesglqpdfplledtiallrelledyerhhlvklddallaavvdryisdeallklldel
00490531   1/1  .iLflDEidklagargsggspdvqnaLlrllergnvrvIa------------------------------
00402381   1/1  aLlqvleegeltdlggrivdlpnvrviaatnpgle-----------------------------------
00462581   1/1  .---------------------------------------------------------------------
00464421   1/1  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00473941   1/1  el--------------------------------------------------------------------
00489391   1/1  dlvifldadpeelleRllkrglrpe.............................................
00404191   1/1  rgv-------------------------------------------------------------------
00368501   1/1  gllvseligappgyvggdlggllteavl------------------------------------------
00432581   1/1  lldkgfgpilelilknaq----------------------------------------------------
00381511   1/1  ----------------------------------------------------------------------
00499331   1/1  rpdlvilldappeelleRllkr................................................
00478391   1/1  fldapleelleRllkr.grhpeseevleerleryepllepea..adlvidts.lsleevveqilel----
00437901   1/1  Eidaldpdvlnallklldglrdlsgvliilttndp-----------------------------------
00462761   1/1  ----------------------------------------------------------------------
00386741   1/1  ggg-------------------------------------------------------------------
00459701   1/1  ----------------------------------------------------------------------
00527961   1/1  aeel.kflglklvglltgglslke......d---------------------------------------
00511381   1/1  vtglemdfa-------------------------------------------------------------
00402371   1/1  dpevqnaLlrlleeg..........nvrviaatnr-----------------------------------
00477721   1/1  ----------------------------------------------------------------------
00457171   1/1  e---------------------------------------------------------------------
00416171   1/1  ltrlgggivlpadvrliaatnpdllelvlegelrpaLldRfdvie-------------------------
00478131   1/1  ----------------------------------------------------------------------
00503741   1/1  l---------------------------------------------------------------------
00420081   1/1  ----------------------------------------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00379261   1/1  gyglggllteavrrlpysvllldelekahrpirvlllsas------------------------------
00434401   1/1  ----------------------------------------------------------------------
00468951   1/1  ----------------------------------------------------------------------
00381411   1/1  ----------------------------------------------------------------------
00482661   1/1  ----------------------------------------------------------------------
00358481   1/1  ----------------------------------------------------------------------
00439861   1/1  pdl-------------------------------------------------------------------
00491901   1/1  ......dlvifldaplevlleRllkrgrdlpelirlrdlerlarlleeledlyeedlvidtdglsleevv
00461621   1/1  ----------------------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00489631   1/1  ----------------------------------------------------------------------
00480251   1/1  ----------------------------------------------------------------------
00478441   1/1  ----------------------------------------------------------------------
00348321   1/1  ----------------------------------------------------------------------
00478411   1/1  ----------------------------------------------------------------------
00496111   1/1  ----------------------------------------------------------------------
00501941   1/1  ----------------------------------------------------------------------
00498531   1/1  ----------------------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00479331   1/1  ----------------------------------------------------------------------
00506761   1/1  ----------------------------------------------------------------------
00363171   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00448931   1/1  ----------------------------------------------------------------------
00472911   1/1  vifldadpevlleRllkrgrallreevldrllevrepy..elleeadlvidtsglsleevverilellee
00464591   1/1  ----------------------------------------------------------------------
00514991   1/1  ----------------------------------------------------------------------
00420941   1/1  ap--------------------------------------------------------------------
00496571   1/1  ----------------------------------------------------------------------
00486921   1/1  ----------------------------------------------------------------------
00520041   1/1  gpllrlllellprpdlqllllSATpppe..eltlpllrldvllveeslklelllellelllelggkvlvf
00516041   1/1  ----------------------------------------------------------------------
00512061   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00475371   1/1  ----------------------------------------------------------------------
00533501   1/1  ----------------------------------------------------------------------
00444381   1/1  ----------------------------------------------------------------------
00496061   1/1  ----------------------------------------------------------------------
00527261   1/1  la--------------------------------------------------------------------
00493981   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00518511   1/1  ----------------------------------------------------------------------
00532471   1/1  ----------------------------------------------------------------------
00457851   1/1  ----------------------------------------------------------------------
00487021   1/1  ----------------------------------------------------------------------
00498251   1/1  ----------------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00486891   1/1  ----------------------------------------------------------------------
00404101   1/1  ----------------------------------------------------------------------
00500441   1/1  ----------------------------------------------------------------------
00515801   1/1  ----------------------------------------------------------------------
00480501   1/1  ----------------------------------------------------------------------
00418301   1/1  vlflDEidkllpargssggdvsredvlnaLlrlleegelt------------------------------
00457881   1/1  ----------------------------------------------------------------------
00464411   1/1  ----------------------------------------------------------------------
00379601   1/1  ----------------------------------------------------------------------
00387201   1/1  ----------------------------------------------------------------------
00420701   1/1  ----------------------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------
00476071   1/1  ----------------------------------------------------------------------
00381621   1/1  DE--------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           HSVKDFLGVYFNRTKKPEDLFENRIMAYTNASVDKLNAVIRKKLYGSDVAPFLPGEILVMQEPLMFEIDV
00503571   1/1  ......................plediailartnagllgvdalnraleealngagipyplgglrlkvgdp
00489561   1/1  aenplllerlrnrfdhvlvDEaqdtsplqllillalagkgkrlilvGDpkQliysfrgadpslferlikd
00503561   1/1  ----------------------------------------------------------------------
00437941   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00498371   1/1  ----------------------------------------------------------------------
00474201   1/1  ----------------------------------------------------------------------
00437981   1/1  ----------------------------------------------------------------------
00379961   1/1  ----------------------------------------------------------------------
00494911   1/1  ----------------------------------------------------------------------
00476651   1/1  ----------------------------------------------------------------------
00430121   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00477561   1/1  ......................................................................
00367291   1/1  ----------------------------------------------------------------------
00503501   1/1  lkerlallll------------------------------------------------------------
00490531   1/1  ----------------------------------------------------------------------
00402381   1/1  ----------------------------------------------------------------------
00462581   1/1  ----------------------------------------------------------------------
00464421   1/1  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00473941   1/1  ----------------------------------------------------------------------
00489391   1/1  ...................regdseevlekrlerylellerliep-------------------------
00404191   1/1  ----------------------------------------------------------------------
00368501   1/1  ----------------------------------------------------------------------
00432581   1/1  ----------------------------------------------------------------------
00381511   1/1  ----------------------------------------------------------------------
00499331   1/1  ................grldgreddslellekrleryeeltrdlielye---------------------
00478391   1/1  ----------------------------------------------------------------------
00437901   1/1  ----------------------------------------------------------------------
00462761   1/1  ----------------------------------------------------------------------
00386741   1/1  ----------------------------------------------------------------------
00459701   1/1  ----------------------------------------------------------------------
00527961   1/1  ----------------------------------------------------------------------
00511381   1/1  ----------------------------------------------------------------------
00402371   1/1  ----------------------------------------------------------------------
00477721   1/1  ----------------------------------------------------------------------
00457171   1/1  ----------------------------------------------------------------------
00416171   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00503741   1/1  ----------------------------------------------------------------------
00420081   1/1  ----------------------------------------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00379261   1/1  ----------------------------------------------------------------------
00434401   1/1  ----------------------------------------------------------------------
00468951   1/1  ----------------------------------------------------------------------
00381411   1/1  ----------------------------------------------------------------------
00482661   1/1  ----------------------------------------------------------------------
00358481   1/1  ----------------------------------------------------------------------
00439861   1/1  ----------------------------------------------------------------------
00491901   1/1  erilel----------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00489631   1/1  ----------------------------------------------------------------------
00480251   1/1  ----------------------------------------------------------------------
00478441   1/1  ----------------------------------------------------------------------
00348321   1/1  ----------------------------------------------------------------------
00478411   1/1  ----------------------------------------------------------------------
00496111   1/1  ----------------------------------------------------------------------
00501941   1/1  ----------------------------------------------------------------------
00498531   1/1  ----------------------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00479331   1/1  ----------------------------------------------------------------------
00506761   1/1  ----------------------------------------------------------------------
00363171   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00448931   1/1  ----------------------------------------------------------------------
00472911   1/1  ----------------------------------------------------------------------
00464591   1/1  ----------------------------------------------------------------------
00514991   1/1  ----------------------------------------------------------------------
00420941   1/1  ----------------------------------------------------------------------
00496571   1/1  ----------------------------------------------------------------------
00486921   1/1  ----------------------------------------------------------------------
00520041   1/1  vn--------------------------------------------------------------------
00516041   1/1  ----------------------------------------------------------------------
00512061   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00475371   1/1  ----------------------------------------------------------------------
00533501   1/1  ----------------------------------------------------------------------
00444381   1/1  ----------------------------------------------------------------------
00496061   1/1  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00493981   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00518511   1/1  ----------------------------------------------------------------------
00532471   1/1  ----------------------------------------------------------------------
00457851   1/1  ----------------------------------------------------------------------
00487021   1/1  ----------------------------------------------------------------------
00498251   1/1  ----------------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00486891   1/1  ----------------------------------------------------------------------
00404101   1/1  ----------------------------------------------------------------------
00500441   1/1  ----------------------------------------------------------------------
00515801   1/1  ----------------------------------------------------------------------
00480501   1/1  ----------------------------------------------------------------------
00418301   1/1  ----------------------------------------------------------------------
00457881   1/1  ----------------------------------------------------------------------
00464411   1/1  ----------------------------------------------------------------------
00379601   1/1  ----------------------------------------------------------------------
00387201   1/1  ----------------------------------------------------------------------
00420701   1/1  ----------------------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------
00476071   1/1  ----------------------------------------------------------------------
00381621   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           GGQTLKEVIFSNGQNVQILNVKPSRKKLVAKNVGEIEVEYIMLECETHDEDEDDYKRAWFSVIADDNTAQ
00503571   1/1  vml.....lrndpelglfngdigvvlgiae........................................
00489561   1/1  fpgarvitLtenyRstpeildlanalfydnllrlgk........plesllgeggpvvfidadseeeeaea
00503561   1/1  ----------------------------------------------------------------------
00437941   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00498371   1/1  ----------------------------------------------------------------------
00474201   1/1  ----------------------------------------------------------------------
00437981   1/1  ----------------------------------------------------------------------
00379961   1/1  ----------------------------------------------------------------------
00494911   1/1  ----------------------------------------------------------------------
00476651   1/1  ----------------------------------------------------------------------
00430121   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00477561   1/1  .........grpdlviyldapdeelleRllkrrkedrpdlldkdleelleefegrddeyeppyepaddii
00367291   1/1  ----------------------------------------------------------------------
00503501   1/1  ----------------------------------------------------------------------
00490531   1/1  ----------------------------------------------------------------------
00402381   1/1  ----------------------------------------------------------------------
00462581   1/1  ----------------------------------------------------------------------
00464421   1/1  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00473941   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00404191   1/1  ----------------------------------------------------------------------
00368501   1/1  ----------------------------------------------------------------------
00432581   1/1  ----------------------------------------------------------------------
00381511   1/1  ----------------------------------------------------------------------
00499331   1/1  ----------------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00437901   1/1  ----------------------------------------------------------------------
00462761   1/1  ----------------------------------------------------------------------
00386741   1/1  ----------------------------------------------------------------------
00459701   1/1  ----------------------------------------------------------------------
00527961   1/1  ----------------------------------------------------------------------
00511381   1/1  ----------------------------------------------------------------------
00402371   1/1  ----------------------------------------------------------------------
00477721   1/1  ----------------------------------------------------------------------
00457171   1/1  ----------------------------------------------------------------------
00416171   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00503741   1/1  ----------------------------------------------------------------------
00420081   1/1  ----------------------------------------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00379261   1/1  ----------------------------------------------------------------------
00434401   1/1  ----------------------------------------------------------------------
00468951   1/1  ----------------------------------------------------------------------
00381411   1/1  ----------------------------------------------------------------------
00482661   1/1  ----------------------------------------------------------------------
00358481   1/1  ----------------------------------------------------------------------
00439861   1/1  ----------------------------------------------------------------------
00491901   1/1  ----------------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00489631   1/1  ----------------------------------------------------------------------
00480251   1/1  ----------------------------------------------------------------------
00478441   1/1  ----------------------------------------------------------------------
00348321   1/1  ----------------------------------------------------------------------
00478411   1/1  ----------------------------------------------------------------------
00496111   1/1  ----------------------------------------------------------------------
00501941   1/1  ----------------------------------------------------------------------
00498531   1/1  ----------------------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00479331   1/1  ----------------------------------------------------------------------
00506761   1/1  ----------------------------------------------------------------------
00363171   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00448931   1/1  ----------------------------------------------------------------------
00472911   1/1  ----------------------------------------------------------------------
00464591   1/1  ----------------------------------------------------------------------
00514991   1/1  ----------------------------------------------------------------------
00420941   1/1  ----------------------------------------------------------------------
00496571   1/1  ----------------------------------------------------------------------
00486921   1/1  ----------------------------------------------------------------------
00520041   1/1  ----------------------------------------------------------------------
00516041   1/1  ----------------------------------------------------------------------
00512061   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00475371   1/1  ----------------------------------------------------------------------
00533501   1/1  ----------------------------------------------------------------------
00444381   1/1  ----------------------------------------------------------------------
00496061   1/1  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00493981   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00518511   1/1  ----------------------------------------------------------------------
00532471   1/1  ----------------------------------------------------------------------
00457851   1/1  ----------------------------------------------------------------------
00487021   1/1  ----------------------------------------------------------------------
00498251   1/1  ----------------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00486891   1/1  ----------------------------------------------------------------------
00404101   1/1  ----------------------------------------------------------------------
00500441   1/1  ----------------------------------------------------------------------
00515801   1/1  ----------------------------------------------------------------------
00480501   1/1  ----------------------------------------------------------------------
00418301   1/1  ----------------------------------------------------------------------
00457881   1/1  ----------------------------------------------------------------------
00464411   1/1  ----------------------------------------------------------------------
00379601   1/1  ----------------------------------------------------------------------
00387201   1/1  ----------------------------------------------------------------------
00420701   1/1  ----------------------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------
00476071   1/1  ----------------------------------------------------------------------
00381621   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           AISEFLSIIADKYRSRAVFPAWKDFWAIKNTFTKVRPLGAMTFHKSQGSTFKNAYLFTPCLHSYCRDPDV
00503571   1/1  ..................elllllvlldgrlvlllrrrllpldlayamTiHksQGlefdhVilvlpee..
00489561   1/1  vadlilellalrglrpgdiavLvrynaqarlieealrkagipyvivgtvdlfqgpevddilaslvlllnp
00503561   1/1  ----------------------------------------------------------------------
00437941   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00498371   1/1  ----------------------------------------------------------------------
00474201   1/1  ----------------------------------------------------------------------
00437981   1/1  ----------------------------------------------------------------------
00379961   1/1  ----------------------------------------------------------------------
00494911   1/1  ----------------------------------------------------------------------
00476651   1/1  ----------------------------------------------------------------------
00430121   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00477561   1/1  eidlsrleiyevitki------------------------------------------------------
00367291   1/1  ----------------------------------------------------------------------
00503501   1/1  ----------------------------------------------------------------------
00490531   1/1  ----------------------------------------------------------------------
00402381   1/1  ----------------------------------------------------------------------
00462581   1/1  ----------------------------------------------------------------------
00464421   1/1  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00473941   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00404191   1/1  ----------------------------------------------------------------------
00368501   1/1  ----------------------------------------------------------------------
00432581   1/1  ----------------------------------------------------------------------
00381511   1/1  ----------------------------------------------------------------------
00499331   1/1  ----------------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00437901   1/1  ----------------------------------------------------------------------
00462761   1/1  ----------------------------------------------------------------------
00386741   1/1  ----------------------------------------------------------------------
00459701   1/1  ----------------------------------------------------------------------
00527961   1/1  ----------------------------------------------------------------------
00511381   1/1  ----------------------------------------------------------------------
00402371   1/1  ----------------------------------------------------------------------
00477721   1/1  ----------------------------------------------------------------------
00457171   1/1  ----------------------------------------------------------------------
00416171   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00503741   1/1  ----------------------------------------------------------------------
00420081   1/1  ----------------------------------------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00379261   1/1  ----------------------------------------------------------------------
00434401   1/1  ----------------------------------------------------------------------
00468951   1/1  ----------------------------------------------------------------------
00381411   1/1  ----------------------------------------------------------------------
00482661   1/1  ----------------------------------------------------------------------
00358481   1/1  ----------------------------------------------------------------------
00439861   1/1  ----------------------------------------------------------------------
00491901   1/1  ----------------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00489631   1/1  ----------------------------------------------------------------------
00480251   1/1  ----------------------------------------------------------------------
00478441   1/1  ----------------------------------------------------------------------
00348321   1/1  ----------------------------------------------------------------------
00478411   1/1  ----------------------------------------------------------------------
00496111   1/1  ----------------------------------------------------------------------
00501941   1/1  ----------------------------------------------------------------------
00498531   1/1  ----------------------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00479331   1/1  ----------------------------------------------------------------------
00506761   1/1  ----------------------------------------------------------------------
00363171   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00448931   1/1  ----------------------------------------------------------------------
00472911   1/1  ----------------------------------------------------------------------
00464591   1/1  ----------------------------------------------------------------------
00514991   1/1  ----------------------------------------------------------------------
00420941   1/1  ----------------------------------------------------------------------
00496571   1/1  ----------------------------------------------------------------------
00486921   1/1  ----------------------------------------------------------------------
00520041   1/1  ----------------------------------------------------------------------
00516041   1/1  ----------------------------------------------------------------------
00512061   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00475371   1/1  ----------------------------------------------------------------------
00533501   1/1  ----------------------------------------------------------------------
00444381   1/1  ----------------------------------------------------------------------
00496061   1/1  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00493981   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00518511   1/1  ----------------------------------------------------------------------
00532471   1/1  ----------------------------------------------------------------------
00457851   1/1  ----------------------------------------------------------------------
00487021   1/1  ----------------------------------------------------------------------
00498251   1/1  ----------------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00486891   1/1  ----------------------------------------------------------------------
00404101   1/1  ----------------------------------------------------------------------
00500441   1/1  ----------------------------------------------------------------------
00515801   1/1  ----------------------------------------------------------------------
00480501   1/1  ----------------------------------------------------------------------
00418301   1/1  ----------------------------------------------------------------------
00457881   1/1  ----------------------------------------------------------------------
00464411   1/1  ----------------------------------------------------------------------
00379601   1/1  ----------------------------------------------------------------------
00387201   1/1  ----------------------------------------------------------------------
00420701   1/1  ----------------------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------
00476071   1/1  ----------------------------------------------------------------------
00381621   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           AQELIYVGNTRARENVGFV---------------------------------------------------
00503571   1/1  ..gspvlerrllYVAiTRA---------------------------------------------------
00489561   1/1  ldflallrllnvpltragdkl-------------------------------------------------
00503561   1/1  ----------------------------------------------------------------------
00437941   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00498371   1/1  ----------------------------------------------------------------------
00474201   1/1  ----------------------------------------------------------------------
00437981   1/1  ----------------------------------------------------------------------
00379961   1/1  ----------------------------------------------------------------------
00494911   1/1  ----------------------------------------------------------------------
00476651   1/1  ----------------------------------------------------------------------
00430121   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00367291   1/1  ----------------------------------------------------------------------
00503501   1/1  ----------------------------------------------------------------------
00490531   1/1  ----------------------------------------------------------------------
00402381   1/1  ----------------------------------------------------------------------
00462581   1/1  ----------------------------------------------------------------------
00464421   1/1  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00473941   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00404191   1/1  ----------------------------------------------------------------------
00368501   1/1  ----------------------------------------------------------------------
00432581   1/1  ----------------------------------------------------------------------
00381511   1/1  ----------------------------------------------------------------------
00499331   1/1  ----------------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00437901   1/1  ----------------------------------------------------------------------
00462761   1/1  ----------------------------------------------------------------------
00386741   1/1  ----------------------------------------------------------------------
00459701   1/1  ----------------------------------------------------------------------
00527961   1/1  ----------------------------------------------------------------------
00511381   1/1  ----------------------------------------------------------------------
00402371   1/1  ----------------------------------------------------------------------
00477721   1/1  ----------------------------------------------------------------------
00457171   1/1  ----------------------------------------------------------------------
00416171   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00503741   1/1  ----------------------------------------------------------------------
00420081   1/1  ----------------------------------------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00379261   1/1  ----------------------------------------------------------------------
00434401   1/1  ----------------------------------------------------------------------
00468951   1/1  ----------------------------------------------------------------------
00381411   1/1  ----------------------------------------------------------------------
00482661   1/1  ----------------------------------------------------------------------
00358481   1/1  ----------------------------------------------------------------------
00439861   1/1  ----------------------------------------------------------------------
00491901   1/1  ----------------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00489631   1/1  ----------------------------------------------------------------------
00480251   1/1  ----------------------------------------------------------------------
00478441   1/1  ----------------------------------------------------------------------
00348321   1/1  ----------------------------------------------------------------------
00478411   1/1  ----------------------------------------------------------------------
00496111   1/1  ----------------------------------------------------------------------
00501941   1/1  ----------------------------------------------------------------------
00498531   1/1  ----------------------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00479331   1/1  ----------------------------------------------------------------------
00506761   1/1  ----------------------------------------------------------------------
00363171   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00448931   1/1  ----------------------------------------------------------------------
00472911   1/1  ----------------------------------------------------------------------
00464591   1/1  ----------------------------------------------------------------------
00514991   1/1  ----------------------------------------------------------------------
00420941   1/1  ----------------------------------------------------------------------
00496571   1/1  ----------------------------------------------------------------------
00486921   1/1  ----------------------------------------------------------------------
00520041   1/1  ----------------------------------------------------------------------
00516041   1/1  ----------------------------------------------------------------------
00512061   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00475371   1/1  ----------------------------------------------------------------------
00533501   1/1  ----------------------------------------------------------------------
00444381   1/1  ----------------------------------------------------------------------
00496061   1/1  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00493981   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00518511   1/1  ----------------------------------------------------------------------
00532471   1/1  ----------------------------------------------------------------------
00457851   1/1  ----------------------------------------------------------------------
00487021   1/1  ----------------------------------------------------------------------
00498251   1/1  ----------------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00486891   1/1  ----------------------------------------------------------------------
00404101   1/1  ----------------------------------------------------------------------
00500441   1/1  ----------------------------------------------------------------------
00515801   1/1  ----------------------------------------------------------------------
00480501   1/1  ----------------------------------------------------------------------
00418301   1/1  ----------------------------------------------------------------------
00457881   1/1  ----------------------------------------------------------------------
00464411   1/1  ----------------------------------------------------------------------
00379601   1/1  ----------------------------------------------------------------------
00387201   1/1  ----------------------------------------------------------------------
00420701   1/1  ----------------------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------
00476071   1/1  ----------------------------------------------------------------------
00381621   1/1  ----------------------------------------------------------------------