[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for bp441:AAQ81348.1


[Show Plain Result]

## Summary of Sequence Search
   1::152
   2::142  6.9e-51 46.5% 0045259 00452591 1/1   donuclease V                            
   1::152


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTRINLEHPSLLCNAHLVGEWYENPRVASILIKKNGRTGKIPKRFTVRTNKNPDGGRGHVTFFYNKLAWL
00452591   1/1  -tRinlippeeLadqHLlaEyrElprvfnavlksiaalklekvlkiPeeytl........GtGHvtffyd


                         -         -         *         -         -         -         -:140
query           RDRYLMLMDEMTKRGYSPTDNWKVEIFFPEYTHLFGEWTPTEADISLSRTRIAEMIPEKHKLTNEQLEKL
00452591   1/1  klkyLrkRylalveEllaRGynindtaledi.ldvptefvndytPteealklnreRiaerinlkprlyry


                         +         -         -         -         -         *         -:210
query           SAIAEYEAFNEK----------------------------------------------------------
00452591   1/1  tk--------------------------------------------------------------------