[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for bp441:AAQ81419.1


[Show Plain Result]

## Summary of Sequence Search
   1::191
   1::140  3.9e-37 38.1% 0051942 00519421 1/1   p containing nucleoside triphosphate hy 
   1::141  2.1e-35 36.8% 0050906 00509061 1/1   p containing nucleoside triphosphate hy 
   1::141  2.1e-30 34.8% 0051138 00511381 1/1   p containing nucleoside triphosphate hy 
 141::191  4.8e-12 41.2% 0051943 00519431 1/1   corticoid receptor-like (DNA-binding do 
 141::188  1.1e-10 39.6% 0051139 00511391 1/1   corticoid receptor-like (DNA-binding do 
 141::186  7.4e-10 44.7% 0050907 00509071 1/1   corticoid receptor-like (DNA-binding do 
   1::191


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAKLHFHYAAMNSGKSTHLLQVAYNYMERNMKPLILKPAIDTRDGDNVSSRIGISQKAHMISQDDNLKAF
00519421   1/1  pgglvlitGpmgsGKTtlllrllkrleeagkkvlvfkpaldtrylglvasriglsleailvtllldlfel
00509061   1/1  mGkleviyGpmfsGKttellrrlaryeiaglkvlvikpalDtrysglvvsrlglsleallvsslldllel
00511381   1/1  llllkpgglvlitGPtgsGKsttLlralnrleeagkgvilvkdaidtrlgielvvsriglvleavglffa
00519431   1/1  ----------------------------------------------------------------------
00511391   1/1  ----------------------------------------------------------------------
00509071   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           CEKLIELDGIDCILVDEAQFLTVDQVHQLGDVVDYINVPVMCYGLLSDSNGHLFPASAELLVLAERKVEH
00519421   1/1  llrlllrgdidviliDEaqflddelveql.rllanlgilvivaGldtdfrgelfegsaqLlalAdkvteL
00509061   1/1  l......gdvdvvliDeaqfld..dlvelaevladlgipVivaGLdtdfrgepFegvlkLlalAdsvtkl
00511381   1/1  ldllelll.....qdpdviliDEaqfldpevvevllelad.tgilvlvtglemdfagelfegsllLlalA
00519431   1/1  ----------------------------------------------------------------------
00511391   1/1  ----------------------------------------------------------------------
00509071   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           ETICWCGKKATMTMRMNEHGEKIWGPRVSIGGNDRFISVCRRHWKEGKIQK-------------------
00519421   1/1  ----------------------------------------------------------------------
00509061   1/1  k---------------------------------------------------------------------
00511381   1/1  d---------------------------------------------------------------------
00519431   1/1  kaiCvvcgkkAtftlRlvdggkavlegeqvliGgnesYeavCrkhylllll-------------------
00511391   1/1  avcclcgrkAtftlRlvdggkavlegeqvliGgnesYeavCrkcylel----------------------
00509071   1/1  avcllcgrkAtftlrlvd.....dgeqvliGgnelYvavCrkcyle------------------------