[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for bp441:AAQ81437.1


[Show Plain Result]

## Summary of Sequence Search
   1::122
  62::122  1.4e-22 50.8% 0046178 00461781 1/1   ike glycyl radical enzymes              
  64::121  3.5e-21 48.3% 0049134 00491341 1/1   ike glycyl radical enzymes              
   1::122


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLIGFQLLDGSNDHGSIFLVDDQTNNAKVIASKTYEIDTIVEDSVIRGRPGRFFDVQPEPTVEGGQHLNV
00461781   1/1  -------------------------------------------------------------llgghhlqf
00491341   1/1  ---------------------------------------------------------------ggfhlqf


                         -         -         *         -         -         -         -:140
query           NVLDRNTLEDAIVNPEKYPQLTIRVSGYAVRFNALTPEQQRDVITRTFTQSL------------------
00461781   1/1  nvvdrdtLldaqkhPekYpdLiVRVaGYsayfvdLskelqdevisRtehell------------------
00491341   1/1  nvvdretlldAqkhPekyrdLiVRVaGYsayfvdLskelqdeiiaRtehel-------------------