[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for bp441:AAQ81509.1


[Show Plain Result]

## Summary of Sequence Search
   1::234
   1::207  0.00066 20.0% 0049814 00498141 1/1   ike                                     
   1::234


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MQIEKPIILTDVDGVLVQWTSGLPYFAQKNGIRTDEILKTLVDERFRTGEELFGVNGRIADILMREYNNS
00498141   1/1  MlkkikavifDlDgTLvdseplllealdelleelglellll.............................


                         -         -         *         -         -         -         -:140
query           DFIKYLAGYVDAIDVVNRLKEHYDFIAITALGDSNQALMNRCCNLNTLFPGAFKDILCVDIGETKMPHYI
00498141   1/1  ......leelklfpgvlellkalkergiklaivTngsrlelaealleklglddyf....daivssdd..p


                         +         -         -         -         -         *         -:210
query           SVKQKYKDRLVCFVDDLVSNLQDCHDAMSQLPQIHMLRTENAREVKHDIAKYHTAKNWYDIEKLLVNLNP
00498141   1/1  kpeiylkaleklgldpeevlfvgDslndieaakaa..Glktvlvnrgytlkelldlad.........---


                         -         -         -         +         -         -         -:280
query           KPIKMDLSHLSTWEDKPVTIEAKA----------------------------------------------
00498141   1/1  ----------------------------------------------------------------------