[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for bp441:AAQ81516.1


[Show Plain Result]

## Summary of Sequence Search
   1::172
   1::172  1.4e-36 34.1% 0050283 00502831 1/1   ine deaminase-like                      
   1::159  5.9e-27 36.0% 0051727 00517271 1/1   ine deaminase-like                      
   7::163  2.9e-26 39.7% 0044240 00442401 1/1   ine deaminase-like                      
   2::173  3.9e-26 38.1% 0053055 00530551 1/1   ine deaminase-like                      
   1::136  1.4e-25 40.2% 0050730 00507301 1/1   ine deaminase-like                      
   7::173    3e-25 38.1% 0051897 00518971 1/1   ine deaminase-like                      
   1::136    1e-24 40.2% 0050639 00506391 1/1   ine deaminase-like                      
   1::136  3.9e-24 43.1% 0051482 00514821 1/1   ine deaminase-like                      
   1::136  2.4e-23 39.2% 0052851 00528511 1/1   ine deaminase-like                      
   1::136  8.1e-23 43.1% 0051891 00518911 1/1   ine deaminase-like                      
   1::134  1.4e-21 33.7% 0035093 00350931 1/1   ine deaminase-like                      
   1::137  1.5e-12 29.1% 0041046 00410461 1/1   ine deaminase-like                      
  84::137  1.8e-05 37.7% 0052747 00527472 2/2   ine deaminase-like                      
  84::148   0.0067 25.0% 0052373 00523732 2/2   ine deaminase-like                      
   1::40      0.63 27.5% 0052747 00527471 1/2   ine deaminase-like                      
   1::40      0.68 27.5% 0052373 00523731 1/2   ine deaminase-like                      
   1::172


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKVSSVLQHAYIVAQESHCVSWKVGAIITKDGRIISTGYNGTPAGGHENCDDHAKAAGWLDPETGKLKAM
00502831   1/1  mddeyfmrlAlelArrstdpnppvGAvivkdgeiiatgyngvpsgnalclevlallelllallglllldg
00517271   1/1  addeyfmrlAlelarralplgnvpvGAvivkdgeiiatgynlenasgd......................
00442401   1/1  ------leldeyfmrlAlelarraldlgnvpvGAvivdkkdgeiiargynrvlggndpt...........
00530551   1/1  -ldeyfmrlAlelArralgltagnvpvGAvivkdgeiiatgynrvdgta.....................
00507301   1/1  lddeyfmrlAlelarraltygnvpvGAvivddgeiiatgynrvnagldp.....................
00518971   1/1  ------ldeyfmrlAlelArraldlgevnPlvGAvivkdgeiiatgynrvl...................
00506391   1/1  mlsddeyfmrlAlelarralapgsefpvGAvivkdgeiiatgyn..........................
00514821   1/1  selpeddeyfmrlAlelarraltygnvpvGAvivkdgeiiatgynrenaggdp.................
00528511   1/1  lssllplllkallldlllsdlrleldeyfmrlAlelArraldagnvpvGAvivdpsdgeiiatgyn....
00518911   1/1  meldeyfmrlAlelarralpygnfpvGAvivkdgeiiatgynrvnaggdp....................
00350931   1/1  mderlkllleqlelslasylpdlfgpkdllglitallldkllkllrleddelllalaleaanrayapysn
00410461   1/1  eedelllalaleaakrayapyskfpvGAalltedgriytGvn............................
00527472   2/2  ----------------------------------------------------------------------
00523732   2/2  ----------------------------------------------------------------------
00527471   1/2  ldeedeellelAleaakkayapysefpvGAalltddgriy------------------------------
00523731   1/2  ldlelllqaaleaaklayaPyskfpvGAalltedgriytG------------------------------


                         -         -         *         -         -         -         -:140
query           YRQAHNEWSSCNEIHAELNAILYAAKSGQSIDGAEMYVTVSPCRECAKAIAQSGIKKVFYNELYDRNTPG
00502831   1/1  glprlldlesldglllslllllsgelleldptaHAEinAirqaaklgerlkgatlYvTlePCpmCagaii
00517271   1/1  ............ptaHAEinAirqaarllggrrlkgatlyvtlePCpmCagaiieagikrvvygasdpdl
00442401   1/1  .......................aHAEinalrqaarlggellkgatlYvTlePCpmCagaiiqagikrvv
00530551   1/1  .................HAEvnAlrqaarggerlkgatlyvTlePCshlgktpmCagaiiqagikrvvyg
00507301   1/1  .............taHAEinAirqaarllggyrlkgatlyvtlePCpmCagaiieagikrvvygas----
00518971   1/1  ...................ptaHAEvnAlrqa...gvllkgatlyvTlePCsmlgktPpCagaiiqagik
00506391   1/1  ........vengsydptaHAEinAirqaarklggerlkgatlyvtlePCpmCagaiieagikrvvy----
00514821   1/1  .................taHAEinAirqaakllggyrlkgatlyvtlePCpmCagaiieagikrvv----
00528511   1/1  ..............................rvlgsgdptaHAEinAlrqaarllggvrlakylltg----
00518911   1/1  ..............taHAEinAirqaarllggerlkgatlyvtlePCpmCagaiieagikrvvyga----
00350931   1/1  fpvGAvlvtddgriytGan...................................venaaynllr------
00410461   1/1  ......venaaygltlcAErvAilnavlagerklkaivvvgdtlyvtlsPCgmCrqvllefgidtvv---
00527472   2/2  -------------lcAErvAiakavaager.klkaiavvvdtggvtlsPCgmCrqalaefgidtvvy---
00523732   2/2  -------------lcAervAiakavlager.eivaiavvadsdgvlsPcgaCrqvlaellgpdllvilln
00527471   1/2  ----------------------------------------------------------------------
00523731   1/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           WDEILVKSGIKVIHNKVPLNLLKKEFTVSNQN--------------------------------------
00502831   1/1  qagikrvvygdpdpktagggisllrlagievl--------------------------------------
00517271   1/1  galgsgldllpeaglnvrl---------------------------------------------------
00442401   1/1  ygasdpdl..gglglllnagiev-----------------------------------------------
00530551   1/1  aldpdlgvagglllllnagievvvgvleeeale-------------------------------------
00507301   1/1  ----------------------------------------------------------------------
00518971   1/1  rvvygasdpdlgvagsglellrnagievvvgvl-------------------------------------
00506391   1/1  ----------------------------------------------------------------------
00514821   1/1  ----------------------------------------------------------------------
00528511   1/1  ----------------------------------------------------------------------
00518911   1/1  ----------------------------------------------------------------------
00350931   1/1  ----------------------------------------------------------------------
00410461   1/1  ----------------------------------------------------------------------
00527472   2/2  ----------------------------------------------------------------------
00523732   2/2  ldgelkvv--------------------------------------------------------------
00527471   1/2  ----------------------------------------------------------------------
00523731   1/2  ----------------------------------------------------------------------