[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for bpvp2:AAR97635.1


[Show Plain Result]

## Summary of Sequence Search
   1::460
 167::178  PF02012 0.0% 58.3333333333333  BNR/Asp-box repeat 
 217::227  PF02012 0.0% 45.4545454545455  BNR/Asp-box repeat 
 263::272  PF02012 0.0% 60  BNR/Asp-box repeat 
 311::320  PF02012 0.0% 60  BNR/Asp-box repeat 
 355::364  PF02012 0.0% 50  BNR/Asp-box repeat 
 409::418  PF02012 0.0% 50  BNR/Asp-box repeat 
  33::102  PF06832 0.0% 21.7391304347826  Penicillin-Binding Protein C-terminus Family 
   1::460


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAVYIQGQEVLNIVVHVPNSAPTDLGEFRMAEQLAAKQPQITAQPVGGSIYDSQTLGLSIAANVFGSTAA
PF02012         ----------------------------------------------------------------------
PF02012         ----------------------------------------------------------------------
PF02012         ----------------------------------------------------------------------
PF02012         ----------------------------------------------------------------------
PF02012         ----------------------------------------------------------------------
PF02012         ----------------------------------------------------------------------
PF06832         --------------------------------asaasplrIay.Ppdgailaldpdiparqrlvlkargg


                         -         -         *         -         -         -         -:140
query           YQWLVDGAPIQGANSTSFTFVPSGLGTFDVTCEIKAFGPMVTSEVASVTVEQTPVDLTWQVLPAGYGLPS
PF02012         ----------------------------------------------------------------------
PF02012         ----------------------------------------------------------------------
PF02012         ----------------------------------------------------------------------
PF02012         ----------------------------------------------------------------------
PF02012         ----------------------------------------------------------------------
PF02012         ----------------------------------------------------------------------
PF06832         kapltWfldgeplgetgrerelawqpaepGrh--------------------------------------


                         +         -         -         -         -         *         -:210
query           NVSGLVGLNAIGSDGSLVVGAMGMEGMRSTDKGLTWSYIGNGFGTGQTSGTISAICVVGNVVVVGGIAGS
PF02012         --------------------------yyStDgGkTWsl--------------------------------
PF02012         --------------------------yyStDgGkTWsl--------------------------------
PF02012         --------------------------yyStDgGkTWsl--------------------------------
PF02012         --------------------------yyStDgGkTWsl--------------------------------
PF02012         --------------------------yyStDgGkTWsl--------------------------------
PF02012         --------------------------yyStDgGkTWsl--------------------------------
PF06832         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           NIGVAGRSTNGGVSWTKLPDFLNSGATASAINKILHVGGNKLIALLGSGYAAVSNDLGATWSALPRWLNS
PF02012         ------yStDgGkTWsl-----------------------------------yStDgGkTWs--------
PF02012         ------yStDgGkTWsl-----------------------------------yStDgGkTWs--------
PF02012         ------yStDgGkTWsl-----------------------------------yStDgGkTWs--------
PF02012         ------yStDgGkTWsl-----------------------------------yStDgGkTWs--------
PF02012         ------yStDgGkTWsl-----------------------------------yStDgGkTWs--------
PF02012         ------yStDgGkTWsl-----------------------------------yStDgGkTWs--------
PF06832         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           GGSDNNTSFFDGAVTATGAIIAVGQNGFASISRNGGVTWSALPRYLGMPTNTSIVAIGVSDTAIVVGGNN
PF02012         ------------------------------yStDgGkTWs------------------------------
PF02012         ------------------------------yStDgGkTWs------------------------------
PF02012         ------------------------------yStDgGkTWs------------------------------
PF02012         ------------------------------yStDgGkTWs------------------------------
PF02012         ------------------------------yStDgGkTWs------------------------------
PF02012         ------------------------------yStDgGkTWs------------------------------
PF06832         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           GNCAISRNDGVTWSALPLNFGVPIGSGIRDRSIAGASNGTFLVGLSGSPISGNNGYLALSYDDGVTWQQP
PF02012         ----yStDgGkTWs--------------------------------------------yStDgGkTWs--
PF02012         ----yStDgGkTWs--------------------------------------------yStDgGkTWs--
PF02012         ----yStDgGkTWs--------------------------------------------yStDgGkTWs--
PF02012         ----yStDgGkTWs--------------------------------------------yStDgGkTWs--
PF02012         ----yStDgGkTWs--------------------------------------------yStDgGkTWs--
PF02012         ----yStDgGkTWs--------------------------------------------yStDgGkTWs--
PF06832         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           PRYLGIPNAGYGALVNTIRNIDILTFLVGFTDKRGVRAVR------------------------------
PF02012         ----------------------------------------------------------------------
PF02012         ----------------------------------------------------------------------
PF02012         ----------------------------------------------------------------------
PF02012         ----------------------------------------------------------------------
PF02012         ----------------------------------------------------------------------
PF02012         ----------------------------------------------------------------------
PF06832         ----------------------------------------------------------------------