[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for bpvp2:AAR97635.1


[Show Plain Result]

## Summary of Sequence Search
   1::460
 125::449  3.4e-26 31.1% 0049445 00494451 1/1   xyloglucan reducing end-specific cellob 
 160::438  3.6e-24 25.0% 0053333 00533331 1/1   dases                                   
 139::432  1.6e-21 28.4% 0053303 00533031 1/1   dases                                   
 156::425  8.5e-20 25.5% 0050402 00504021 1/1   dases                                   
 184::420  1.5e-19 23.1% 0050334 00503342 2/2   dases                                   
 127::452    3e-17 25.0% 0043715 00437151 1/1   xyloglucan reducing end-specific cellob 
 156::420  3.3e-14 22.2% 0048217 00482171 1/1   dases                                   
 184::418  1.1e-09 26.2% 0041196 00411961 1/1   dases                                   
 174::435    1e-06 24.4% 0049431 00494311 1/1   dases                                   
 127::182       12 24.5% 0050334 00503341 1/2   dases                                   
   1::460


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAVYIQGQEVLNIVVHVPNSAPTDLGEFRMAEQLAAKQPQITAQPVGGSIYDSQTLGLSIAANVFGSTAA
00494451   1/1  ----------------------------------------------------------------------
00533331   1/1  ----------------------------------------------------------------------
00533031   1/1  ----------------------------------------------------------------------
00504021   1/1  ----------------------------------------------------------------------
00503342   2/2  ----------------------------------------------------------------------
00437151   1/1  ----------------------------------------------------------------------
00482171   1/1  ----------------------------------------------------------------------
00411961   1/1  ----------------------------------------------------------------------
00494311   1/1  ----------------------------------------------------------------------
00503341   1/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           YQWLVDGAPIQGANSTSFTFVPSGLGTFDVTCEIKAFGPMVTSEVASVTVEQTPVDLTWQVLPAGYGLPS
00494451   1/1  ------------------------------------------------------ggytWtpvgdglgggs
00533331   1/1  ----------------------------------------------------------------------
00533031   1/1  --------------------------------------------------------------------lk
00504021   1/1  ----------------------------------------------------------------------
00503342   2/2  ----------------------------------------------------------------------
00437151   1/1  --------------------------------------------------------stwkvvgiv..ggg
00482171   1/1  ----------------------------------------------------------------------
00411961   1/1  ----------------------------------------------------------------------
00494311   1/1  ----------------------------------------------------------------------
00503341   1/2  --------------------------------------------------------ktWseptdltp...


                         +         -         -         -         -         *         -:210
query           NVSGLVGLNAIGSDGSLVVGAMGMEGMRSTDKGLTWSYIGNGFGTGQTSGTISAICVVGNVVVVGGIAGS
00494451   1/1  ....igalavdpsnpnllyvgtdegglyrstdggktWtpvgl......dslgvsaiaidptdpnrvyaag
00533331   1/1  -------------------ergaalggvvdlsvpgatwvlikdgdggtvdslripslvelpdgtllavae
00533031   1/1  lillsldvtllnglewellgpllvggvvsllavprdgntlyaggasggvwrStDgGktWtpitdvprfss
00504021   1/1  ---------------ilfvpnltdgvfrstdeggtw..............ripslvidpdgslvafadgg
00503342   2/2  -------------------------------------------eglydsyripalvvdptdpgtllaaae
00437151   1/1  tvtglvalpa..dggrllavgdggglyrstdgGktWtpvtdllagdgfnassitsiavdpvdgdllyaat
00482171   1/1  ---------------vllllvvmmccgsgaaaaktwlfvggegt..vhslripslvptdgdllavaearc
00411961   1/1  -------------------------------------------gtgvdslripsLvevggvllavaearc
00494311   1/1  ---------------------------------lavtvlfvagtdgvasyriPalvtlpdsgtllafaea
00503341   1/2  ....gpgsgivlvrntiaidpsngrlvvpvyayrggglvsgl----------------------------


                         -         -         -         +         -         -         -:280
query           NIGVAGRSTNGGVSWTKLPDFLNSGATASAINKILHVGGNKLIALLGSGYAAVSNDLGATWSALPRWLNS
00494451   1/1  ggglggdnndggvlrStDgGktWtkvllplggnglsrtgvsllavdptdpgilyagtwngeggglykStD
00533331   1/1  aregsgddagdigivlrrstdgGktWsapsllltagltdklvrvgnPtlvvdpkdgtiyllvgayglgls
00533031   1/1  itaiafspsnrfvwkdvkggegvsyripslvyagggvllvaeaegtgsgvdkstdlgktwvivglgtadg
00504021   1/1  lgsaggsdglqlvlakstDgGetWsplglilalgggadtvgvvdpalavdpldgrlflvagryedgneid
00503342   2/2  grlngsgteegagdidivlrrStDgGktWsailvvldatgngdlgrvgdptlvvddpdgtlfllagswpl
00437151   1/1  gryvggsdgtll.rStDgGktWtrvalpfklpgndlgagdgeplavhpldagtllagtrdgglyrStDgG
00482171   1/1  gglgdsgdigivvrrstDgGktWselvlvvnsddgaaltvldptlvvdggkiyllvgsyslrrdawgqts
00411961   1/1  gkgvdsgftgiv.varstdgGktWsplvlplsssdwkavgvsrpttvvdggriyllvgsyslgadagsia
00494311   1/1  ryngddegaidivlrrStdggktnlveWsepqvvldatlgglrvgdpvlvvdaktgriflfyvavpggvs
00503341   1/2  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           GGSDNNTSFFDGAVTATGAIIAVGQNGFASISRNGGVTWSALPRYLGMPTNTSIVAIGVSDTAIVVGGNN
00494451   1/1  gGatWskl.tglpdgg......llsvavdplnpgtvyagts.ggvyrStDgGktWtavndglvggtvsai
00533331   1/1  agspvedgllwglllvdggvyrStDgGktWskvpvlltdgvtgpgslttlaggpgsgivlkdGtlvfpvy
00533031   1/1  glyrStDgGkvndstWsavtvllklktqvleelsldgklrpqfhaallttpgpgrvgvpnllvdpdggdi
00504021   1/1  irsnedgdgpgtarillyrStDgGrTWsevaaltdlptgpiwegflvgpgsgillddgenpGtlvvpvsv
00503342   2/2  lvspwdpgggwagtddlglykStDgGktWseptdltpgpgsgivlvrntiaidpsngrlvvpvyayrggg
00437151   1/1  ktWtkvsg.lpdavtdglglgsvlfdptnggrlyvavsekgglyrSdDgGatWtailgglrgslpggaaf
00482171   1/1  ggdgwglllvvggvsdglllrStDgGktWseptdltpgllglakggsltelaagggsgivledgtlvfpv
00411961   1/1  wsaddpglllvvgnvgdlallrStDgGitWseptslppgvggaalsgsltgflggggsgivmkdgtlvfp
00494311   1/1  ewsqigtglntarlllvrStDdGkTWse.prdltdqvkgpvksgwatlavgpghgiqllasdGrlvvpay
00503341   1/2  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           GNCAISRNDGVTWSALPLNFGVPIGSGIRDRSIAGASNGTFLVGLSGSPISGNNGYLALSYDDGVTWQQP
00494451   1/1  avsplddgtlyagtrdggvyrStDgGatWtkvtsplpaslglpapgssvsaiavspadpgtlyvagn...
00533331   1/1  atrkggggvlpvsllyySdD.GktWtlskglpgggciepsvvel.dgrllmlarnd.grrrvyrStDgGe
00533031   1/1  lllavspsdggvgwaggddglllvStDgGktWspldlpaalpg..gslgriavgpgsgvvlddnsnpgtl
00504021   1/1  lldnggfgvalyyStDgGktWqlvnlp...pagliepvivvlpdGslvalarssggdgkvllyvStDgGk
00503342   2/2  lvsglyySdDgGkTWtlgngvppalaldlslggdgigcyepsvvelpdgrlllyarteggqrldgllggk
00437151   1/1  vpdgrvyidalqvsglalpdgrlylatngrggvlggtrggvlistdgGatWtllsppagdsegapvncld
00482171   1/1  yatkkdgktvsliyySdDgGktWtlskgvspagcsepsvvel.dgkllmlartddgrrrvyeStDgGktW
00411961   1/1  vyatkkdggtvsliiyStDgGktWtlskgvspggcsdpsvvew.dgkllmvtgcgggrrrvyeStDgG--
00494311   1/1  atlvgdsndggslvslliySdDgGkTWtlgavvpdganepqvvel..pdGrlllnarsdgnlggrrlval
00503341   1/2  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           PRYLGIPNAGYGALVNTIRNIDILTFLVGFTDKRGVRAVR------------------------------
00494451   1/1  .dggagglyrStDgGktWtrindglpgpg-----------------------------------------
00533331   1/1  tWtelgtlsgvlgnpdsg----------------------------------------------------
00533031   1/1  yapgeggkggds----------------------------------------------------------
00504021   1/1  tWsvv-----------------------------------------------------------------
00503342   2/2  ----------------------------------------------------------------------
00437151   1/1  kcslhlhglalvpladgtlvaaggdgnvgdgl--------------------------------------
00482171   1/1  ----------------------------------------------------------------------
00411961   1/1  ----------------------------------------------------------------------
00494311   1/1  StDgGetWsepvlvl-------------------------------------------------------
00503341   1/2  ----------------------------------------------------------------------