[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for bsub0:CAB11952.2


[Show Plain Result]

## Summary of Sequence Search
   1::483
  55::135  PF07949 0.0% 32  YbbR-like protein 
 143::228  PF07949 0.0% 31.25  YbbR-like protein 
 237::316  PF07949 0.0% 38.75  YbbR-like protein 
 339::394  PF07949 0.0% 22.6415094339623  YbbR-like protein 
   1::483


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDKFLNNRWAVKIIALLFALLLYVAVNSNQAPTPKKPGESFFPTSTTDEATLTDIPVKAYYDDENYVVTG
PF07949         ------------------------------------------------------vPVekventgelaegy
PF07949         ------------------------------------------------------vPVekventgelaegy
PF07949         ------------------------------------------------------vPVekventgelaegy
PF07949         ------------------------------------------------------vPVekventgelaegy


                         -         -         *         -         -         -         -:140
query           VPQTVNVTIKGSTSAVKKARQTKNFEIYADMEHLKTGTHKVELKAKNVSDGLTISINPSVTTVTIQERTT
PF07949         vvvsgtpepvtVtvtGpesvl...dkieevkaevyvDlsglke...dvtvevklllpdgnveveP-----
PF07949         vvvsgtpepvtVtvtGpesvl...dkieevkaevyvDlsglke...dvtvevklllpdgnveveP-----
PF07949         vvvsgtpepvtVtvtGpesvl...dkieevkaevyvDlsglke...dvtvevklllpdgnveveP-----
PF07949         vvvsgtpepvtVtvtGpesvl...dkieevkaevyvDlsglke...dvtvevklllpdgnveveP-----


                         +         -         -         -         -         *         -:210
query           KSFPVEVEYYNKSKMKKGYSPEQPIVSPKNVQITGSKNVIDNISLVKASVNLENADETIEKEAKVTVYDK
PF07949         --vPVe.kventgelaegyvvvsgtpepvtVtvtGpesvldkieevkaevyvDlsglkedvtvevklllp
PF07949         --vPVe.kventgelaegyvvvsgtpepvtVtvtGpesvldkieevkaevyvDlsglkedvtvevklllp
PF07949         --vPVe.kventgelaegyvvvsgtpepvtVtvtGpesvldkieevkaevyvDlsglkedvtvevklllp
PF07949         --vPVe.kventgelaegyvvvsgtpepvtVtvtGpesvldkieevkaevyvDlsglkedvtvevklllp


                         -         -         -         +         -         -         -:280
query           DGNALPVDVEPSVIKITVPVTSPSKKVPFKIERTGSLPDGVSIANIESSPSEVTVYGSQDVLDSLEFIDG
PF07949         dgnveve.....PstvtV--------vPVekventgelaegyvvvsgtpepvtVtvtGpesvldkieevk
PF07949         dgnveve.....PstvtV--------vPVekventgelaegyvvvsgtpepvtVtvtGpesvldkieevk
PF07949         dgnveve.....PstvtV--------vPVekventgelaegyvvvsgtpepvtVtvtGpesvldkieevk
PF07949         dgnveve.....PstvtV--------vPVekventgelaegyvvvsgtpepvtVtvtGpesvldkieevk


                         -         *         -         -         -         -         +:350
query           VSLDLSKINKDSDIEADIPLPDGVKKISPSKVTLHIEVDSEADQKFENVPIKTVGLSSSQNIEFLDPESQ
PF07949         aevyvDlsglkedvtvevklllpdgnvevePstvtV----------------------aegyvvvsgtpe
PF07949         aevyvDlsglkedvtvevklllpdgnvevePstvtV----------------------aegyvvvsgtpe
PF07949         aevyvDlsglkedvtvevklllpdgnvevePstvtV----------------------aegyvvvsgtpe
PF07949         aevyvDlsglkedvtvevklllpdgnvevePstvtV----------------------aegyvvvsgtpe


                         -         -         -         -         *         -         -:420
query           AIDVTAKGSPTNINKLKKSDIELYVNVSDLEDGEHSVKLEVNGPQNVTWSLGRKNAKIKLTSKKSNTSTN
PF07949         pvtVtvtGpesvldkieevkaevyvDlsglke...dvtvevkll--------------------------
PF07949         pvtVtvtGpesvldkieevkaevyvDlsglke...dvtvevkll--------------------------
PF07949         pvtVtvtGpesvldkieevkaevyvDlsglke...dvtvevkll--------------------------
PF07949         pvtVtvtGpesvldkieevkaevyvDlsglke...dvtvevkll--------------------------


                         -         -         +         -         -         -         -:490
query           DNSSNTSGNQDTDKQTNDQKNNQQEDTKNTDKNNNDQNQDGNKDQNQDQDEDESTANSQSSSE-------
PF07949         ----------------------------------------------------------------------
PF07949         ----------------------------------------------------------------------
PF07949         ----------------------------------------------------------------------
PF07949         ----------------------------------------------------------------------